[back]

COFACTOR result for job id 76476

[Download result.tar.bz2 for all prediction results]

User Input

>76476 (820 residues)
MKKILIGLSTFSLLVSSSSIVSCTITYQFKNNYLDQLKMILNTSSIAAQSIILSDKNTTN
ISTDYSLKTFSQTKINDLYKNEEKKLADKYVIDKKATYEYQFKSMFLSLENQKWTETLKK
ITTIDKNNQTTNLDLAWNDQNTKTTDNNIFKTLSLASAGFNFLFSGDFTPNQQGDLINNF
LSNQFGLLASTVFKDNQFSNLIDQLNNIDNNQFYNLTNSLLTQPEWLNSDKENNLTKKTL
KEILESSSKKLWDQILPKDGKQDFKIDWSKVFKPLIDLLKAFSIYYEQVEQRSDKNLTYQ
TIDPLHLFIKEKTNSEFLYEVLNTDLQTIYKNKSEDQIKQEINSINLKKIISFLKNTLVF
DKEDKHGYKFQKFVVILLGSASQKESQNDITNNFLLKPFYTWYEKNEELVKKIITSKLEK
IESIKPYASFVSNITPILFKVIKAFHQDLTEQGLNKKLSSELSSYLSLAKTLLPTLSVDK
KVIDFLDSKSLKDFLNNPFLALYKQNFLKEVFQLINQLSNKEVINNQIIDNVSNVYNLTT
LKLDKLLNYLLELIKKPSPSKTSLDEFQFLYGLKDLSISQIINNLSTFYNKENLDYIFNL
SNFKNLLEAIFNKNITMSFKYKNQEKELKTQNNLSTILAILGLNSNYTKDLKIEIKDDKN
NISQKIKQLIEQKQYGLISVILLGFDADKKQFYKDSILDNIANLFGHNDKDINKEASKNA
INILIKSYLELINWFQNVSLKKYAKDNFSTYLDQNNWSTELIDKKGNIENLSKPLIIDYM
LKYKNPKDDNQNWKFKVSITRTSDFEQPWKISEITKLTNN

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1qgkA	0.89	2.91	0.105	0.959	Download
2	4xriA	0.81	4.31	0.096	0.939	Download
3	3w3tA	0.67	5.43	0.088	0.843	Download
4	3ea5B	0.65	5.63	0.086	0.826	Download
5	6ez8A	0.65	6.68	0.067	0.887	Download
6	1wa5C	0.64	5.98	0.079	0.845	Download
7	6n1zA	0.62	6.03	0.067	0.802	Download
8	5yz0A	0.61	5.80	0.055	0.773	Download
9	4c0oA	0.60	6.45	0.083	0.802	Download
10	5vchA	0.59	6.74	0.069	0.815	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.97	catalytic activity
GO:0005215	0.71	transporter activity
GO:0016740	0.65	transferase activity
GO:0016787	0.59	hydrolase activity
GO:0008757	0.56	S-adenosylmethionine-dependent methyltransferase activity
GO:0008565	0.55	protein transporter activity
GO:0046539	0.52	histamine N-methyltransferase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0008152	0.88	metabolic process
GO:0009987	0.83	cellular process
GO:0071704	0.75	organic substance metabolic process
GO:0044237	0.75	cellular metabolic process
GO:0071702	0.74	organic substance transport
GO:0006807	0.74	nitrogen compound metabolic process
GO:1901360	0.72	organic cyclic compound metabolic process
GO:0046483	0.72	heterocycle metabolic process
GO:0044238	0.72	primary metabolic process
GO:0034641	0.72	cellular nitrogen compound metabolic process
GO:0006725	0.72	cellular aromatic compound metabolic process
GO:0044765	0.71	single-organism transport
GO:0006139	0.71	nucleobase-containing compound metabolic process
GO:0043170	0.66	macromolecule metabolic process
GO:0090304	0.65	nucleic acid metabolic process
GO:0008104	0.60	protein localization
GO:0015031	0.59	protein transport
GO:0051649	0.56	establishment of localization in cell
GO:0032259	0.55	methylation
GO:0006607	0.55	NLS-bearing protein import into nucleus
GO:0071705	0.54	nitrogen compound transport
GO:0065007	0.52	biological regulation
GO:0050789	0.52	regulation of biological process
GO:0044260	0.51	cellular macromolecule metabolic process
GO:0050794	0.50	regulation of cellular process
GO:0019222	0.50	regulation of metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005737	1.00	cytoplasm
GO:0005634	1.00	nucleus
GO:0044446	0.78	intracellular organelle part
GO:0044428	0.70	nuclear part
GO:0044444	0.68	cytoplasmic part
GO:0016020	0.66	membrane
GO:0005829	0.56	cytosol

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1b0pA	0.330	8.62	0.046	0.529	1.2.7.1	NA
2	0.060	2e1qA	0.334	8.46	0.037	0.526	1.17.3.2 1.17.1.4	NA
3	0.060	3lxuX	0.327	8.52	0.032	0.517	3.4.14.10	NA
4	0.060	3h09B	0.309	8.25	0.047	0.482	3.4.21.72	NA
5	0.060	1llwA	0.398	8.76	0.045	0.648	1.4.7.1	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Click to view	Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
	1	0.01	2dqmA	0.406	7.27	0.045	0.573	0.16	BES	Download	1,2,9,12

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]