[back]

COFACTOR result for job id 76403

[Download result.tar.bz2 for all prediction results]

User Input

>76403 (225 residues)
MKKYIIAPSVLSANFMELKNELELCKKNNINWIHYDVMDFDFVPNLTFGSKILHDIKKNI
DINVDVHFMVSVKTKQFEDFFSDYIKAKPEMMTMHIESLKDDNTINKFIDLCKQNNILAS
LAISPKTDVSLVYPYLDKLDNVLVMSVEPGFGGQKFISSSLEKIQILDQLRNTKNYKYTI
EVDGGINEQTSVLVKQAGVDMIVAGSYLFGSDDFTKRAKGLFDEL

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2fliC	0.95	0.65	0.350	0.964	Download
2	5umfA	0.95	0.55	0.389	0.960	Download
3	1rpxA	0.95	1.03	0.353	0.969	Download
4	3inpA	0.93	0.82	0.336	0.951	Download
5	1tqjC	0.93	0.92	0.315	0.947	Download
6	4nu7A	0.92	1.37	0.332	0.964	Download
7	1tqxA	0.92	1.16	0.364	0.951	Download
8	1h1yA	0.91	1.17	0.347	0.947	Download
9	3ovpA	0.90	1.23	0.340	0.942	Download
10	3ct7A	0.90	1.48	0.294	0.951	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0046872	1.00	metal ion binding
GO:0004750	1.00	ribulose-phosphate 3-epimerase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044281	1.00	small molecule metabolic process
GO:0019693	1.00	ribose phosphate metabolic process
GO:0019682	1.00	glyceraldehyde-3-phosphate metabolic process
GO:0005975	1.00	carbohydrate metabolic process
GO:0044262	0.99	cellular carbohydrate metabolic process
GO:0019323	0.99	pentose catabolic process
GO:0009052	0.99	pentose-phosphate shunt, non-ox.dat.gzive branch
GO:0006807	0.56	nitrogen compound metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044444	1.00	cytoplasmic part
GO:0005829	0.99	cytosol

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.460	1tqjC	0.926	0.92	0.315	0.947	5.1.3.1	34,36,65,67,183
2	0.316	2czfA	0.730	2.68	0.135	0.853	4.1.1.23	95
3	0.230	2fliC	0.952	0.65	0.350	0.964	5.1.3.1	NA
4	0.216	3ct7A	0.896	1.48	0.294	0.951	5.1.3.-	NA
5	0.211	1h1yA	0.911	1.17	0.347	0.947	5.1.3.1	183

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.78	2fliI	0.947	0.66	0.352	0.960	1.79	DX5	Download	9,11,36,149,150,151,152,153,183,184,185,205,206
2	0.77	1h1yA	0.911	1.17	0.347	0.947	1.85	SO4	Download	152,153,185,205,206
3	0.52	1so3A	0.783	2.95	0.121	0.920	0.98	TX4	Download	9,11,34,67,69,183,185,203,205,206
4	0.23	1ixpA	0.774	2.72	0.078	0.911	1.22	PO4	Download	183,184,185,204,205,206
5	0.20	1a53A	0.770	2.63	0.095	0.884	0.84	IGP	Download	8,10,67,69,93,123,145,183,184,185,203,205,206
6	0.19	1ixnA	0.773	2.78	0.073	0.911	0.95	G3P	Download	9,143,184,185,203,205,206
7	0.07	1h1y0	0.911	1.17	0.347	0.947	1.04	III	Download	14,15,16,17,18,19,37,39,41,46,47,48,49,51,52,55,56,59
8	0.04	1kv80	0.777	2.97	0.126	0.916	0.83	III	Download	49,50,71,72,76,77,79,80,83,95,97,124,125,126,147

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]