[back]

COFACTOR result for job id 76363

[Download result.tar.bz2 for all prediction results]

User Input

>76363 (336 residues)
MKTKQLEQPDFSALLDSEREAFFKRHGLDIYQIDHSLFELVGSQAQTSETIITKPYSYWK
AVGKILITSKVFIICSIILLALLLTSIIVPYGKEAIPLKTPGVTQEHPSAQHWFGLGRNG
EDYWIEIWLGLRSSLSFAFVMTFLQLSIGIIMGLIWGYYRKLDILFYQLTSLILVIPQLI
LIIVIMSVFGIGYWPMILGIVIQAWIGPAFSIRILVLSIRDADYNIASITLGTRSDKIIR
KNVLPKILPVLIQVSTFSIPTAIAIESTLAYFDRGFVDGKVNTSLGKILQSIMQSSEWQV
YPHLIVLPILFICIISTLFFLVLKVFADSLDPKNHR

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4tquM	0.57	2.64	0.075	0.640	Download
2	2r6gF	0.54	2.87	0.096	0.616	Download
3	2r6gG	0.54	3.54	0.112	0.643	Download
4	2onkC	0.54	2.79	0.105	0.607	Download
5	4ymsD	0.54	2.92	0.117	0.610	Download
6	4tquN	0.53	3.51	0.093	0.631	Download
7	3d31C	0.52	2.90	0.152	0.595	Download
8	3dhwA	0.52	1.95	0.177	0.554	Download
9	2rd5B	0.25	6.55	0.037	0.414	Download
10	2cf6A1	0.23	6.31	0.026	0.372	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005215	1.00	transporter activity
GO:0022857	0.99	transmembrane transporter activity
GO:0003824	0.80	catalytic activity
GO:0016787	0.62	hydrolase activity
GO:0022892	0.60	substrate-specific transporter activity
GO:0016462	0.57	pyrophosphatase activity
GO:0017111	0.56	nucleoside-triphosphatase activity
GO:0022804	0.55	active transmembrane transporter activity
GO:0016887	0.55	ATPase activity
GO:0042623	0.54	ATPase activity, coupled
GO:0022891	0.53	substrate-specific transmembrane transporter activity
GO:0042626	0.50	ATPase activity, coupled to transmembrane movement of substances

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0006810	1.00	transport
GO:0055085	0.92	transmembrane transport
GO:0071702	0.62	organic substance transport
GO:0071705	0.56	nitrogen compound transport
GO:0006811	0.56	ion transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0044425	1.00	membrane part
GO:0044459	0.99	plasma membrane part
GO:0016021	0.99	integral component of membrane
GO:0005887	0.98	integral component of plasma membrane
GO:0016020	0.85	membrane
GO:0005886	0.82	plasma membrane
GO:0032991	0.65	macromolecular complex
GO:0044424	0.60	intracellular part
GO:1902494	0.56	catalytic complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1llwA	0.383	6.74	0.032	0.661	1.4.7.1	NA
2	0.060	2pflA	0.368	6.89	0.050	0.631	2.3.1.54	243
3	0.060	3b8cB	0.397	5.75	0.052	0.598	3.6.3.6	149,151
4	0.060	1galA	0.378	6.76	0.060	0.652	1.1.3.4	115
5	0.060	3ixzA	0.440	5.74	0.031	0.652	3.6.3.10	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.03	3puvF	0.533	2.94	0.092	0.613	0.78	MAL	Download	149,208,211,212,215,248,252,255
2	0.01	3ar4A	0.395	6.07	0.031	0.622	0.63	PTY	Download	141,149,153
3	0.01	2dqsA	0.427	5.85	0.073	0.640	0.62	PTY	Download	149,153,160
4	0.01	2agvA	0.396	6.15	0.035	0.622	0.68	PTY	Download	96,121,126,129,130
5	0.01	3ar3A	0.396	6.04	0.035	0.616	0.62	PTY	Download	142,145,149,153
6	0.01	2voyK	0.089	1.39	0.094	0.092	1.15	III	Download	123,127,130,131,138

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]