[back]

COFACTOR result for job id 76353

[Download result.tar.bz2 for all prediction results]

User Input

>76353 (304 residues)
MNSHSLVFNYRDNKHFLQEMHTIIKKRGPKTFEEWMVNNNFDSAYIPVTIVNERNGVLAV
SGFIKSKAIINKTVLNTILLTNTFTKAKESNPLMVNELIQGVVKKYENISDFIYTFSNVE
NDDVLIRNGFKKIKEYTYFMQWDPNKEAKLSVLKRLDLDTNQADFEFVKDELFHSSKNNS
LFYIREDGALPIYSLLKYYRNNVFYISNLDAIVIFSINNKTFQLIGLYSKNEIDVLELLD
AIVPKGISLIEFYFVPNIKSKFVVKELRKVMAADCQHRSFLYVRQSTTNLEASKFVVPLL
NRLK

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2i00C	0.88	1.84	0.095	0.934	Download
2	3sxnA	0.85	2.50	0.083	0.951	Download
3	3r1kA	0.84	2.46	0.085	0.934	Download
4	2hv2A	0.82	2.49	0.079	0.918	Download
5	3n7zA	0.81	2.63	0.090	0.918	Download
6	2ozgA	0.81	2.58	0.079	0.918	Download
7	4my3A1	0.73	3.18	0.109	0.872	Download
8	2wpxA	0.62	4.51	0.062	0.842	Download
9	4rs2A	0.46	3.04	0.074	0.530	Download
10	2cnmA	0.41	2.56	0.089	0.454	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0008080	1.00	N-acetyltransferase activity
GO:0034212	0.91	peptide N-acetyltransferase activity
GO:0004596	0.90	peptide alpha-N-acetyltransferase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0071704	1.00	organic substance metabolic process
GO:0044237	1.00	cellular metabolic process
GO:0044238	0.99	primary metabolic process
GO:0043170	0.95	macromolecule metabolic process
GO:0044260	0.94	cellular macromolecule metabolic process
GO:0044267	0.92	cellular protein metabolic process
GO:0043412	0.92	macromolecule modification
GO:0006464	0.91	cellular protein modification process
GO:0006473	0.90	protein acetylation
GO:0006474	0.89	N-terminal protein amino acid acetylation
GO:1901135	0.56	carbohydrate derivative metabolic process
GO:0065007	0.55	biological regulation
GO:0050896	0.55	response to stimulus
GO:0040007	0.53	growth
GO:0006807	0.53	nitrogen compound metabolic process
GO:1901657	0.51	glycosyl compound metabolic process
GO:1901575	0.51	organic substance catabolic process
GO:0065008	0.51	regulation of biological quality
GO:0050794	0.51	regulation of cellular process
GO:0009605	0.51	response to external stimulus

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0031248	0.98	protein acetyltransferase complex
GO:0005737	0.64	cytoplasm
GO:0044444	0.59	cytoplasmic part
GO:0043226	0.50	organelle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.066	3iu2A	0.635	4.80	0.082	0.875	2.3.1.97	NA
2	0.066	3h5zA	0.626	4.85	0.078	0.868	2.3.1.97	NA
3	0.060	2vqyA	0.394	3.60	0.105	0.480	2.3.1.82	6
4	0.060	2pflA	0.395	6.72	0.044	0.694	2.3.1.54	NA
5	0.060	1l5jA	0.421	6.36	0.025	0.717	4.2.1.3	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Click to view	Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
	1	0.23	3r1kA	0.842	2.46	0.085	0.934	1.17	COA	Download	28,83,84,85,90,91,92,93,94,95,96,116,118,121,123,124,125,127

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]