[back]

COFACTOR result for job id 76339

[Download result.tar.bz2 for all prediction results]

User Input

>76339 (404 residues)
MYLKVIRDNVHGDIYFDDVIYIQLINTYEMQRLRRILQLAGTQLAYPSATHTRFSHCIGT
YYILKEFFKNKAFLKISSYEQKLVKIAGLLHDIGHGAFSHTFEKITHKNHEQYTSEIILN
KKGNIYPILKKHHINPQDIVDIINGTYKNKIINLLVSSQIDADRFDYLKRDSISCGVDYA
TLDFKWMIRNAFIIGDKIVFPKKTIYAIESYLLGRYHMYQQVYNHKTSTIFDAMFISWFK
RVTDLFNNNYKFKDNRIIELFINVFNNKDIDLDAYLKIDDYLMFDIFKNCSSEKDVILSD
LSKRLTDRKLFTIRDEKLINKTTLINKLNKLGLDPTYYLLEANIRPLSMYNPVIKNNKDE
NIYLYDSNNQQVHELSYYSKLVKFFQKSNSQKNLRKIIFPKEIV

Download query sequence and structure

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3irhC	0.98	0.60	0.329	0.985	Download
2	2q14C	0.87	1.89	0.272	0.918	Download
3	2hekA	0.80	2.23	0.284	0.861	Download
4	6brgA	0.77	2.91	0.246	0.861	Download
5	3u1nA	0.76	3.17	0.244	0.861	Download
6	4x9eA	0.52	4.41	0.121	0.648	Download
7	2dqbE	0.51	4.06	0.117	0.621	Download
8	2pgsA	0.51	4.25	0.127	0.624	Download
9	3jsiA1	0.35	4.15	0.096	0.436	Download
10	3hc1A	0.32	4.86	0.169	0.406	Download

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0008832	1.00	dGTPase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0006203	1.00	dGTP catabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0005634	1.00	nucleus
GO:0005622	1.00	intracellular
GO:0044444	0.59	cytoplasmic part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2is4B	0.362	7.08	0.045	0.609	3.6.1.-	NA
2	0.060	3ecnB	0.395	5.51	0.085	0.557	3.1.4.17	NA
3	0.060	1b41A	0.365	7.31	0.041	0.631	3.1.1.7	NA
4	0.060	2r8qA	0.399	5.10	0.096	0.537	3.1.4.17	NA
5	0.060	2dqbA	0.508	4.17	0.109	0.626	3.1.5.1	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	2dqbC	0.513	4.09	0.112	0.629	0.36	MG	Download	49,171,176
2	0.01	3sl8C	0.390	5.44	0.092	0.542	0.26	JN7	Download	56,60,63,64,67
3	0.01	3bjcA	0.379	5.61	0.105	0.542	0.25	WAN	Download	89,90,92
4	0.01	3sl5C	0.392	5.48	0.101	0.545	0.15	J25	Download	36,53,57,93,94
5	0.01	1xlxA	0.396	5.54	0.092	0.557	0.23	CIO	Download	88,89,92
6	0.01	1udtA	0.397	5.34	0.127	0.545	0.12	VIA	Download	7,174,176
7	0.01	1y2dA	0.391	5.36	0.105	0.535	0.29	4DE	Download	90,118,124
8	0.01	1y2jA	0.396	5.64	0.080	0.564	0.15	7DE	Download	39,55,58,62,92
9	0.01	1t9sA	0.402	5.15	0.123	0.547	0.13	5GP	Download	42,50,53,176,177
10	0.01	3tgeA	0.409	5.08	0.127	0.552	0.23	TGE	Download	30,31,54,55,58,59,62

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Download result.tar.bz2 for all prediction results]

Reference:

Chengxin Zhang, Peter L Freddolino, and Yang Zhang. COFACTOR: Improved protein function prediction by combining structure, sequence, and protein-protein interaction information. Nucleic Acids Research, 45: W291-299 (2017)
Ambrish Roy, Jianyi Yang, and Yang Zhang. COFACTOR: An accurate comparative algorithm for structure-based protein function annotation. Nucleic Acids Research, 40:W471-W477 (2012).

[back]