D-I-TASSER Q9BYW1

D-I-TASSER results for Q9BYW1

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q9BYW1
Protein Name: Solute carrier family 2, facilitated glucose transporter member 11
Gene Name: SLC2A11

Input Sequence in FASTA format

>Q9BYW1 (496 residues)
MRALRRLIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEPLPD
HLVLLMWSLIVSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGS
FEMIMLGRLLVGVNAGVSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLRE
LLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLA
GELEELEEERAACQGCRARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYASSVF
RKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCWGSIFTVALC
LQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWIMLI
LVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISKELHRLNFPRRA
QGPTWRSLEVIQSTEL

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q9BYW1-D1	1-256	256		MRALRRLIQGRILLLTICAAGIGGTFQFGYNLSIINAPTLHIQEFTNETWQARTGEPLPDHLVLLMWSLIVSLYPLGGLFGALLAGPLAITLGRKKSLLVNNIFVVSAAILFGFSRKAGSFEMIMLGRLLVGVNAGVSMNIQPMYLGESAPKELRGAVAMSSAIFTALGIVMGQVVGLRELLGGPQAWPLLLASCLVPGALQLASLPLLPESPRYLLIDCGDTEACLAALRRLRGSGDLAGELEELEEERAACQGC
2	Q9BYW1-D2	257-496	240		RARRPWELFQHRALRRQVTSLVVLGSAMELCGNDSVYAYASSVFRKAGVPEAKIQYAIIGTGSCELLTAVVSCVVIERVGRRVLLIGGYSLMTCWGSIFTVALCLQSSFPWTLYLAMACIFAFILSFGIGPAGVTGILATELFDQMARPAACMVCGALMWIMLILVGLGFPFIMEALSHFLYVPFLGVCVCGAIYTGLFLPETKGKTFQEISKELHRLNFPRRAQGPTWRSLEVIQSTEL

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.89

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	7crzA	0.89	2.12	0.335	0.946	model1_7crzA.pdb.gz
2	6h7dA	0.86	2.71	0.206	0.948	model1_6h7dA.pdb.gz
3	6thaA	0.84	2.23	0.366	0.903	model1_6thaA.pdb.gz
4	4ybqA	0.83	2.68	0.386	0.909	model1_4ybqA.pdb.gz
5	4gbyA	0.83	2.50	0.217	0.901	model1_4gbyA.pdb.gz
6	4ldsA1	0.42	2.14	0.281	0.446	model1_4ldsA1.pdb.gz
7	4zowA1	0.36	2.49	0.176	0.385	model1_4zowA1.pdb.gz
8	2d0pA	0.29	7.73	0.022	0.492	model1_2d0pA.pdb.gz
9	1z6aA	0.25	7.50	0.050	0.423	model1_1z6aA.pdb.gz
10	2pokA1	0.23	6.09	0.044	0.329	model1_2pokA1.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0022891	1.00	substrate-specific transmembrane transporter activity
GO:0051119	0.86	sugar transmembrane transporter activity
GO:0015291	0.83	secondary active transmembrane transporter activity
GO:0008324	0.83	cation transmembrane transporter activity
GO:0015149	0.82	hexose transmembrane transporter activity
GO:0005355	0.81	glucose transmembrane transporter activity
GO:0015293	0.80	symporter activity
GO:0015294	0.79	solute:cation symporter activity
GO:0005351	0.78	sugar:proton symporter activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.99	single-organism process
GO:0006810	0.99	transport
GO:0071702	0.98	organic substance transport
GO:0044765	0.98	single-organism transport
GO:0008645	0.97	hexose transport
GO:0015758	0.96	glucose transport
GO:0055085	0.95	transmembrane transport
GO:0035428	0.93	hexose transmembrane transport
GO:0046323	0.83	glucose import
GO:0008152	0.63	metabolic process
GO:1904659	0.62	glucose transmembrane transport
GO:0065007	0.59	biological regulation
GO:0071704	0.58	organic substance metabolic process
GO:0050896	0.58	response to stimulus
GO:0044710	0.56	single-organism metabolic process
GO:0044237	0.55	cellular metabolic process
GO:0010033	0.55	response to organic substance
GO:1901700	0.54	response to oxygen-containing compound
GO:0051716	0.54	cellular response to stimulus
GO:0044281	0.54	small molecule metabolic process
GO:0065008	0.53	regulation of biological quality
GO:1901701	0.52	cellular response to oxygen-containing compound
GO:0098739	0.52	import across plasma membrane
GO:0071310	0.52	cellular response to organic substance
GO:0015755	0.52	fructose transport
GO:0009746	0.52	response to hexose
GO:1990539	0.51	fructose import across plasma membrane
GO:0071332	0.51	cellular response to fructose stimulus
GO:0003044	0.51	regulation of systemic arterial blood pressure mediated by a chemical signal
GO:0006811	0.50	ion transport

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0044425	0.96	membrane part
GO:0016021	0.95	integral component of membrane
GO:0044459	0.92	plasma membrane part
GO:0005887	0.91	integral component of plasma membrane
GO:0044424	0.50	intracellular part
GO:0016020	0.50	membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	3b9jJ	0.239	6.64	0.058	0.359	1.17.1.4 1.17.3.2	85,101,108
2	0.060	1h0hA	0.313	7.60	0.028	0.530	1.2.1.2	NA
3	0.060	1ofdA	0.294	7.68	0.030	0.496	1.4.7.1	NA
4	0.060	2cqsA	0.306	7.94	0.030	0.544	2.4.1.20	NA
5	0.060	3cxhN	0.342	5.96	0.076	0.490	1.10.2.2	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	2qjyM	0.354	6.59	0.073	0.538	0.46	LOP	complex1.pdb.gz	132,133,136,137,416,423
2	0.01	2fynG	0.343	6.34	0.051	0.510	0.42	HEM	complex2.pdb.gz	29,101,102,105,106,108,109,134,135,138,141
3	0.01	1zrtC	0.354	6.50	0.065	0.532	0.44	HEM	complex3.pdb.gz	26,27,28,30,31,105,106,108,112,131,134
4	0.01	2rddA	0.360	7.69	0.076	0.611	0.40	AIC	complex4.pdb.gz	387,388,389,390
5	0.01	2qjkA	0.353	6.62	0.070	0.538	0.42	HEM	complex5.pdb.gz	24,27,28,94,97,98,101,102,104,105,135
6	0.01	3aodA	0.367	7.61	0.078	0.617	0.41	MIY	complex6.pdb.gz	23,24,138,141

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.