D-I-TASSER Q8TDV0

D-I-TASSER results for Q8TDV0

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q8TDV0
Protein Name: G-protein coupled receptor 151
Gene Name: GPR151

Input Sequence in FASTA format

>Q8TDV0 (419 residues)
MLAAAFADSNSSSMNVSFAHLHFAGGYLPSDSQDWRTIIPALLVAVCLVGFVGNLCVIGI
LLHNAWKGKPSMIHSLILNLSLADLSLLLFSAPIRATAYSKSVWDLGWFVCKSSDWFIHT
CMAAKSLTIVVVAKVCFMYASDPAKQVSIHNYTIWSVLVAIWTVASLLPLPEWFFSTIRH
HEGVEMCLVDVPAVAEEFMSMFGKLYPLLAFGLPLFFASFYFWRAYDQCKKRGTKTQNLR
NQIRSKQVTVMLLSIAIISALLWLPEWVAWLWVWHLKAAGPAPPQGFIALSQVLMFSISS
ANPLIFLVMSEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKVPSPESPASIP
EKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQDNDPIPWEHEDQETGEGVK

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q8TDV0-D1	1-419	419		MLAAAFADSNSSSMNVSFAHLHFAGGYLPSDSQDWRTIIPALLVAVCLVGFVGNLCVIGILLHNAWKGKPSMIHSLILNLSLADLSLLLFSAPIRATAYSKSVWDLGWFVCKSSDWFIHTCMAAKSLTIVVVAKVCFMYASDPAKQVSIHNYTIWSVLVAIWTVASLLPLPEWFFSTIRHHEGVEMCLVDVPAVAEEFMSMFGKLYPLLAFGLPLFFASFYFWRAYDQCKKRGTKTQNLRNQIRSKQVTVMLLSIAIISALLWLPEWVAWLWVWHLKAAGPAPPQGFIALSQVLMFSISSANPLIFLVMSEEFREGLKGVWKWMITKKPPTVSESQETPAGNSEGLPDKVPSPESPASIPEKEKPSSPSSGKGKTEKAEIPILPDVEQFWHERDTVPSVQDNDPIPWEHEDQETGEGVK

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.7354

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2ks9A	0.78	2.61	0.175	0.845	model1_2ks9A.pdb.gz
2	2hpyA	0.76	2.44	0.148	0.816	model1_2hpyA.pdb.gz
3	4zwjA	0.73	3.25	0.129	0.819	model1_4zwjA.pdb.gz
4	2ziyA	0.70	3.08	0.133	0.778	model1_2ziyA.pdb.gz
5	6me6A	0.67	2.80	0.182	0.738	model1_6me6A.pdb.gz
6	5wb1A	0.66	3.56	0.129	0.757	model1_5wb1A.pdb.gz
7	6i9kA	0.65	2.42	0.119	0.699	model1_6i9kA.pdb.gz
8	6d26A	0.64	3.62	0.166	0.735	model1_6d26A.pdb.gz
9	6me2A	0.64	2.68	0.163	0.702	model1_6me2A.pdb.gz
10	4n6hA	0.64	3.41	0.166	0.716	model1_4n6hA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004888	1.00	transmembrane signaling receptor activity
GO:0004930	0.85	G-protein coupled receptor activity
GO:0001653	0.63	peptide receptor activity
GO:0008528	0.62	G-protein coupled peptide receptor activity
GO:0043167	0.56	ion binding
GO:0043169	0.55	cation binding
GO:0046872	0.54	metal ion binding
GO:0003824	0.54	catalytic activity
GO:0098772	0.53	molecular function regulator
GO:0016787	0.52	hydrolase activity
GO:0042578	0.51	phosphoric ester hydrolase activity
GO:0004896	0.51	cytokine receptor activity
GO:0046914	0.50	transition metal ion binding
GO:0019956	0.50	chemokine binding
GO:0008092	0.50	cytoskeletal protein binding
GO:0004950	0.50	chemokine receptor activity
GO:0004629	0.50	phospholipase C activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0050794	0.98	regulation of cellular process
GO:0007165	0.97	signal transduction
GO:0007186	0.91	G-protein coupled receptor signaling pathway
GO:0009987	0.73	cellular process
GO:0044699	0.72	single-organism process
GO:0044763	0.66	single-organism cellular process
GO:0050896	0.64	response to stimulus
GO:0008152	0.60	metabolic process
GO:0032501	0.59	multicellular organismal process
GO:0071704	0.58	organic substance metabolic process
GO:0044238	0.58	primary metabolic process
GO:0044237	0.57	cellular metabolic process
GO:0007166	0.57	cell surface receptor signaling pathway
GO:0044260	0.56	cellular macromolecule metabolic process
GO:1901700	0.55	response to oxygen-containing compound
GO:0065008	0.55	regulation of biological quality
GO:0051716	0.55	cellular response to stimulus
GO:0050790	0.55	regulation of catalytic activity
GO:0035556	0.55	intracellular signal transduction
GO:0010033	0.55	response to organic substance
GO:0071310	0.54	cellular response to organic substance
GO:0051345	0.54	positive regulation of hydrolase activity
GO:0048519	0.54	negative regulation of biological process
GO:0044710	0.54	single-organism metabolic process
GO:0006810	0.54	transport
GO:0048523	0.53	negative regulation of cellular process
GO:0044765	0.53	single-organism transport
GO:0043087	0.53	regulation of GTPase activity
GO:0032879	0.53	regulation of localization
GO:0055085	0.52	transmembrane transport
GO:0033993	0.52	response to lipid
GO:0014070	0.52	response to organic cyclic compound
GO:0009605	0.52	response to external stimulus
GO:0006928	0.52	movement of cell or subcellular component
GO:1901701	0.51	cellular response to oxygen-containing compound
GO:0071396	0.51	cellular response to lipid
GO:0051704	0.51	multi-organism process
GO:0016477	0.51	cell migration
GO:0016043	0.51	cellular component organization
GO:0007204	0.51	positive regulation of cytosolic calcium ion concentration
GO:0006796	0.51	phosphate-containing compound metabolic process
GO:0006464	0.51	cellular protein modification process
GO:0002376	0.51	immune system process
GO:1903514	0.50	calcium ion transport from endoplasmic reticulum to cytosol
GO:0097305	0.50	response to alcohol
GO:0071219	0.50	cellular response to molecule of bacterial origin
GO:0070296	0.50	sarcoplasmic reticulum calcium ion transport
GO:0051209	0.50	release of sequestered calcium ion into cytosol
GO:0039663	0.50	membrane fusion involved in viral entry into host cell
GO:0036336	0.50	dendritic cell migration
GO:0036314	0.50	response to sterol
GO:0032496	0.50	response to lipopolysaccharide
GO:0030595	0.50	leukocyte chemotaxis
GO:0023014	0.50	signal transduction by protein phosphorylation
GO:0019932	0.50	second-messenger-mediated signaling
GO:0019221	0.50	cytokine-mediated signaling pathway
GO:0007187	0.50	G-protein coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0016021	1.00	integral component of membrane
GO:0016020	1.00	membrane
GO:0005886	0.98	plasma membrane
GO:0044459	0.95	plasma membrane part
GO:0031226	0.94	intrinsic component of plasma membrane
GO:0005887	0.92	integral component of plasma membrane
GO:0044424	0.71	intracellular part
GO:0097458	0.59	neuron part
GO:0042995	0.59	cell projection
GO:0043226	0.57	organelle
GO:0043227	0.52	membrane-bounded organelle
GO:0043229	0.51	intracellular organelle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.068	3d4sA	0.596	2.86	0.185	0.654	3.2.1.17	80
2	0.060	1xmeA	0.432	5.91	0.054	0.640	1.9.3.1	NA
3	0.060	2ohyB	0.396	6.67	0.045	0.647	5.4.3.6	221
4	0.060	2o6yA	0.398	6.73	0.049	0.652	4.3.1.-	NA
5	0.060	2nyfA	0.394	6.51	0.041	0.630	4.3.1.5	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.09	2i37A	0.708	1.96	0.162	0.749	0.73	UUU	complex1.pdb.gz	51,55,85,86
2	0.04	2rh1A	0.599	2.96	0.186	0.661	0.93	CLR	complex2.pdb.gz	48,52,55,56,89
3	0.01	1xepA	0.172	4.77	0.029	0.224	0.59	CAQ	complex3.pdb.gz	51,54,55
4	0.01	1c6dA	0.171	4.87	0.029	0.224	0.53	KR	complex4.pdb.gz	50,53,54,81
5	0.01	1c6fA	0.171	4.89	0.036	0.224	0.58	AR	complex5.pdb.gz	50,53,83

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.