D-I-TASSER Q8NFG4

D-I-TASSER results for Q8NFG4

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q8NFG4
Protein Name: Folliculin
Gene Name: FLCN

Input Sequence in FASTA format

>Q8NFG4 (579 residues)
MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRA
HSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSI
VRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRI
YLINSWPFLLGKVRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARS
LTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEGAPTEDTLVQMEKLADLEEESESWD
NSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLRHMRQVLGAPS
FRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGL
SPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGP
TILNKIEAALTNQNLSVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILG
ASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q8NFG4-D1	1-276	276		MNAIVALCHFCELHGPRTLFCTEVLHAPLPQGDGNEDSPGQGEQAEEEEGGIQMNSRMRAHSPAEGASVESSSPGPKKSDMCEGCRSLAAGHPGYISHDKETSIKYVSHQHPSHPQLFSIVRQACVRSLSCEVCPGREGPIFFGDEQHGFVFSHTFFIKDSLARGFQRWYSIITIMMDRIYLINSWPFLLGKVRGIIDELQGKALKVFEAEQFGCPQRAQRMNTAFTPFLHQRNGNAARSLTSLTSDDNLWACLHTSFAWLLKACGSRLTEKLLEG
2	Q8NFG4-D2	277-495	219		APTEDTLVQMEKLADLEEESESWDNSEAEEEEKAPVLPESTEGRELTQGPAESSSLSGCGSWQPRKLPVFKSLRHMRQVLGAPSFRMLAWHVLMGNQVIWKSRDVDLVQSAFEVLRTMLPVGCVRIIPYSSQYEEAYRCNFLGLSPHVQIPPHVLSSEFAVIVEVHAAARSTLHPVGCEDDQSLSKYEFVVTSGSPVAADRVGPTILNKIEAALTNQNL
3	Q8NFG4-D3	496-579	84		SVDVVDQCLVCLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMTGLSKTYKSHLMSTVRSPTASESRN

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.68

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1llwA	0.38	7.49	0.028	0.610	model1_1llwA.pdb.gz
2	6vr4A	0.38	7.80	0.053	0.625	model1_6vr4A.pdb.gz
3	6ggyA	0.37	7.48	0.046	0.589	model1_6ggyA.pdb.gz
4	6aayA	0.37	7.88	0.055	0.608	model1_6aayA.pdb.gz
5	5h3zA	0.37	7.77	0.028	0.606	model1_5h3zA.pdb.gz
6	6m5aA	0.37	7.42	0.044	0.575	model1_6m5aA.pdb.gz
7	5nz7A	0.37	7.26	0.047	0.573	model1_5nz7A.pdb.gz
8	5ikyA	0.37	8.35	0.034	0.634	model1_5ikyA.pdb.gz
9	2xsgA	0.37	7.80	0.064	0.596	model1_2xsgA.pdb.gz
10	6h3iA	0.36	7.45	0.040	0.567	model1_6h3iA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0032403	1.00	protein complex binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0045892	1.00	negative regulation of transcription, DNA-templated
GO:0044767	1.00	single-organism developmental process
GO:2001170	0.99	negative regulation of ATP biosynthetic process
GO:2000973	0.99	regulation of pro-B cell differentiation
GO:2000506	0.99	negative regulation of energy homeostasis
GO:1901723	0.99	negative regulation of cell proliferation involved in kidney development
GO:1900181	0.99	negative regulation of protein localization to nucleus
GO:0070373	0.99	negative regulation of ERK1 and ERK2 cascade
GO:0051898	0.99	negative regulation of protein kinase B signaling
GO:0045944	0.99	positive regulation of transcription from RNA polymerase II promoter
GO:0045785	0.99	positive regulation of cell adhesion
GO:0043065	0.99	positive regulation of apoptotic process
GO:0035065	0.99	regulation of histone acetylation
GO:0035024	0.99	negative regulation of Rho protein signal transduction
GO:0032465	0.99	regulation of cytokinesis
GO:0032008	0.99	positive regulation of TOR signaling
GO:0032007	0.99	negative regulation of TOR signaling
GO:0031929	0.99	TOR signaling
GO:0030511	0.99	positive regulation of transforming growth factor beta receptor signaling pathway
GO:0030336	0.99	negative regulation of cell migration
GO:0030308	0.99	negative regulation of cell growth
GO:0030097	0.99	hemopoiesis
GO:0010823	0.99	negative regulation of mitochondrion organization
GO:0007043	0.99	cell-cell junction assembly
GO:0001934	0.99	positive regulation of protein phosphorylation
GO:0000122	0.99	negative regulation of transcription from RNA polymerase II promoter
GO:0032501	0.79	multicellular organismal process
GO:0044707	0.78	single-multicellular organism process
GO:0001701	0.77	in utero embryonic development

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0043229	1.00	intracellular organelle
GO:0005737	1.00	cytoplasm
GO:0005911	0.99	cell-cell junction
GO:0005886	0.99	plasma membrane
GO:0005634	0.99	nucleus
GO:0044291	0.98	cell-cell contact zone
GO:0030496	0.98	midbody

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1ea0A	0.329	7.51	0.032	0.513	1.4.1.13	121
2	0.060	3hkzJ	0.329	7.95	0.054	0.544	2.7.7.6	172
3	0.060	2e1qA	0.339	8.23	0.040	0.582	1.17.3.2 1.17.1.4	NA
4	0.060	2vdcF	0.328	7.42	0.039	0.508	1.4.1.13	NA
5	0.060	3b9jJ	0.175	6.75	0.057	0.259	1.17.1.4 1.17.3.2	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	2x2iC	0.348	7.50	0.032	0.553	0.21	QPS	complex1.pdb.gz	11,16,18,155
2	0.01	2x2iB	0.346	7.35	0.044	0.542	0.20	QPS	complex2.pdb.gz	164,165,167,168
3	0.01	2cqsA	0.348	7.75	0.056	0.563	0.17	BGC	complex3.pdb.gz	11,12,165
4	0.01	1b0pA	0.359	7.80	0.018	0.582	0.30	SF4	complex4.pdb.gz	82,83,84,85

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.