D-I-TASSER Q8N6C8

D-I-TASSER results for Q8N6C8

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q8N6C8
Protein Name: Leukocyte immunoglobulin-like receptor subfamily A member 3
Gene Name: LILRA3

Input Sequence in FASTA format

>Q8N6C8 (439 residues)
MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHL
YREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTG
AYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRA
IFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGE
KLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGA
YNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKE
GAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS
GAAETLSPPQNKSDSKAGE

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q8N6C8-D1	1-121	121		MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTGA
2	Q8N6C8-D2	122-221	100		YSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPG
3	Q8N6C8-D3	222-323	102		VSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGAYNLSSEWSAPSDPLDILITGQIR
4	Q8N6C8-D4	324-439	116		ARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKEGAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVSGAAETLSPPQNKSDSKAGE

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.63

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6x3aA	0.48	4.34	0.085	0.615	model1_6x3aA.pdb.gz
2	1cwvA	0.46	5.23	0.046	0.624	model1_1cwvA.pdb.gz
3	3eifA	0.45	5.40	0.060	0.626	model1_3eifA.pdb.gz
4	4e9lA	0.44	5.40	0.106	0.606	model1_4e9lA.pdb.gz
5	5u8qA	0.44	6.30	0.042	0.658	model1_5u8qA.pdb.gz
6	2dtgE	0.44	6.07	0.043	0.631	model1_2dtgE.pdb.gz
7	4m00A	0.44	6.42	0.051	0.670	model1_4m00A.pdb.gz
8	1f02I	0.35	5.53	0.073	0.481	model1_1f02I.pdb.gz
9	1r6vA	0.30	7.66	0.048	0.524	model1_1r6vA.pdb.gz
10	1fnhA	0.29	5.38	0.054	0.403	model1_1fnhA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004872	0.76	receptor activity
GO:0004867	0.64	serine-type endopeptidase inhibitor activity
GO:0004871	0.61	signal transducer activity
GO:0038023	0.59	signaling receptor activity
GO:0004888	0.56	transmembrane signaling receptor activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.89	biological regulation
GO:0050789	0.89	regulation of biological process
GO:0050794	0.85	regulation of cellular process
GO:0050896	0.76	response to stimulus
GO:0009987	0.75	cellular process
GO:0048519	0.68	negative regulation of biological process
GO:0048523	0.67	negative regulation of cellular process
GO:0019222	0.66	regulation of metabolic process
GO:0060255	0.65	regulation of macromolecule metabolic process
GO:0031323	0.65	regulation of cellular metabolic process
GO:0080090	0.64	regulation of primary metabolic process
GO:0006950	0.64	response to stress
GO:0006952	0.63	defense response
GO:0051246	0.62	regulation of protein metabolic process
GO:0031324	0.62	negative regulation of cellular metabolic process
GO:0010605	0.62	negative regulation of macromolecule metabolic process
GO:0007165	0.62	signal transduction
GO:0051248	0.61	negative regulation of protein metabolic process
GO:0016043	0.51	cellular component organization
GO:0010951	0.50	negative regulation of endopeptidase activity
GO:0006461	0.50	protein complex assembly
GO:0002682	0.50	regulation of immune system process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.90	cell part
GO:0005576	0.66	extracellular region
GO:0044425	0.61	membrane part
GO:0044459	0.57	plasma membrane part
GO:0044424	0.57	intracellular part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2v5yA	0.383	5.71	0.044	0.540	3.1.3.48	209
2	0.060	3b43A	0.405	5.43	0.086	0.560	2.7.11.1	142,159
3	0.060	2nziA	0.360	4.95	0.045	0.478	2.7.11.1	NA
4	0.060	1eurA	0.157	7.34	0.034	0.264	3.2.1.18	NA
5	0.060	2c9aA	0.257	4.77	0.106	0.324	3.1.3.48	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	1edh0	0.304	4.54	0.075	0.392	0.24	III	complex1.pdb.gz	126,220,224,308
2	0.01	2qkiD	0.314	6.20	0.039	0.471	0.15	III	complex2.pdb.gz	138,139,223
3	0.01	3qd1X	0.434	4.94	0.049	0.579	0.21	RMY	complex3.pdb.gz	138,192,221,222
4	0.01	3cmvB	0.331	7.36	0.037	0.563	0.20	ANP	complex4.pdb.gz	138,139,140,220
5	0.01	1mq80	0.315	3.87	0.135	0.387	0.16	III	complex5.pdb.gz	161,196,198,200
6	0.01	2omy1	0.173	3.13	0.067	0.198	0.18	III	complex6.pdb.gz	27,28,51,81
7	0.01	1ncg0	0.164	3.45	0.072	0.189	0.23	III	complex7.pdb.gz	120,197,198,199,208

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.