D-I-TASSER Q8N4K4

D-I-TASSER results for Q8N4K4

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q8N4K4
Protein Name: Reprimo-like protein
Gene Name: RPRML

Input Sequence in FASTA format

>Q8N4K4 (120 residues)
MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDER
SLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q8N4K4-D1	1-120	120		MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDERSLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.5032

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3l39A	0.58	3.07	0.061	0.767	model1_3l39A.pdb.gz
2	6ovbA	0.57	3.69	0.053	0.858	model1_6ovbA.pdb.gz
3	3pblA1	0.57	3.58	0.048	0.825	model1_3pblA1.pdb.gz
4	4yayA2	0.57	3.86	0.087	0.842	model1_4yayA2.pdb.gz
5	1ciyA	0.57	3.87	0.035	0.858	model1_1ciyA.pdb.gz
6	6i9kA	0.56	3.75	0.038	0.858	model1_6i9kA.pdb.gz
7	6lfpA1	0.56	3.76	0.047	0.825	model1_6lfpA1.pdb.gz
8	2z73A	0.56	3.90	0.019	0.867	model1_2z73A.pdb.gz
9	1ji6A	0.56	3.86	0.072	0.833	model1_1ji6A.pdb.gz
10	6wpcA	0.56	4.03	0.035	0.867	model1_6wpcA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004888	0.51	transmembrane signaling receptor activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0007050	1.00	cell cycle arrest
GO:0007346	0.50	regulation of mitotic cell cycle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0016021	1.00	integral component of membrane
GO:0016020	1.00	membrane
GO:0005737	1.00	cytoplasm
GO:0005886	0.79	plasma membrane
GO:0031226	0.76	intrinsic component of plasma membrane
GO:0005887	0.67	integral component of plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2ix6E	0.500	3.92	0.042	0.792	1.3.3.6	73
2	0.060	2qb0B	0.348	4.92	0.074	0.667	3.2.1.17	NA
3	0.060	3ee4A	0.503	4.15	0.110	0.783	1.17.4.1	NA
4	0.060	2etfB	0.497	4.82	0.088	0.883	3.4.24.69	NA
5	0.060	2htnG	0.508	3.65	0.077	0.717	1.16.3.1	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.04	2vt4B	0.548	4.05	0.073	0.858	0.80	SOG	complex1.pdb.gz	75,79,83,98,99
2	0.03	2vt4D	0.543	3.85	0.067	0.850	0.74	SOG	complex2.pdb.gz	81,82,86,95,96,102
3	0.03	2ycwA	0.552	4.12	0.081	0.875	0.57	2CV	complex3.pdb.gz	82,85,86,92,98
4	0.03	2vt4C	0.548	4.05	0.073	0.858	0.53	SOG	complex4.pdb.gz	81,82,89,91,92,98
5	0.01	2y03A	0.544	3.96	0.091	0.850	0.55	2CV	complex5.pdb.gz	82,87,90,91,94
6	0.01	2y00A	0.544	3.95	0.056	0.867	0.83	2CV	complex6.pdb.gz	101,106,118
7	0.01	2y04B	0.546	4.03	0.073	0.858	0.60	2CV	complex7.pdb.gz	67,68,114,119
8	0.01	2y01B	0.544	3.93	0.056	0.867	0.52	2CV	complex8.pdb.gz	81,82,91,95
9	0.01	2vt4A	0.549	4.15	0.056	0.883	0.61	SOG	complex9.pdb.gz	82,94,95,98,99

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.