D-I-TASSER Q8N4G2

D-I-TASSER results for Q8N4G2

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q8N4G2
Protein Name: ADP-ribosylation factor-like protein 14
Gene Name: ARL14

Input Sequence in FASTA format

>Q8N4G2 (192 residues)
MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNLSL
TVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVL
LANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMK
SRGDTLAFFKQN

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q8N4G2-D1	1-192	192		MGSLGSKNPQTKQAQVLLLGLDSAGKSTLLYKLKLAKDITTIPTIGFNVEMIELERNLSLTVWDVGGQEKMRTVWGCYCENTDGLVYVVDSTDKQRLEESQRQFEHILKNEHIKNVPVVLLANKQDMPGALTAEDITRMFKVKKLCSDRNWYVQPCCALTGEGLAQGFRKLTGFVKSHMKSRGDTLAFFKQN

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.8535

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3dofA	0.87	2.17	0.368	0.938	model1_3dofA.pdb.gz
2	4m9qA	0.85	1.85	0.326	0.906	model1_4m9qA.pdb.gz
3	6bbpA	0.84	1.91	0.402	0.896	model1_6bbpA.pdb.gz
4	1r4aA	0.83	1.09	0.412	0.859	model1_1r4aA.pdb.gz
5	3lvqE	0.82	1.09	0.414	0.854	model1_3lvqE.pdb.gz
6	5di3A	0.82	1.24	0.396	0.854	model1_5di3A.pdb.gz
7	6s5fA	0.82	2.44	0.198	0.922	model1_6s5fA.pdb.gz
8	4basA	0.81	1.41	0.339	0.859	model1_4basA.pdb.gz
9	2h57B	0.81	1.25	0.319	0.849	model1_2h57B.pdb.gz
10	2rgnA	0.80	2.32	0.257	0.911	model1_2rgnA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0035639	0.98	purine ribonucleoside triphosphate binding
GO:0032555	0.98	purine ribonucleotide binding
GO:0032550	0.98	purine ribonucleoside binding
GO:0003824	0.98	catalytic activity
GO:0005525	0.97	GTP binding
GO:0003924	0.97	GTPase activity
GO:0098772	0.51	molecular function regulator
GO:0019003	0.50	GDP binding
GO:0005102	0.50	receptor binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.98	biological regulation
GO:0050794	0.97	regulation of cellular process
GO:0007264	0.95	small GTPase mediated signal transduction
GO:0006810	0.87	transport
GO:0009987	0.83	cellular process
GO:0051641	0.81	cellular localization
GO:0044699	0.80	single-organism process
GO:0051649	0.79	establishment of localization in cell
GO:0016192	0.79	vesicle-mediated transport
GO:0046907	0.76	intracellular transport
GO:0044763	0.74	single-organism cellular process
GO:0048193	0.72	Golgi vesicle transport
GO:0006888	0.68	ER to Golgi vesicle-mediated transport
GO:0006890	0.67	retrograde vesicle-mediated transport, Golgi to ER
GO:0071840	0.63	cellular component organization or biogenesis
GO:0016043	0.62	cellular component organization
GO:1902578	0.57	single-organism localization
GO:0008104	0.57	protein localization
GO:0006996	0.56	organelle organization
GO:0044765	0.55	single-organism transport
GO:0008152	0.54	metabolic process
GO:0051128	0.53	regulation of cellular component organization
GO:0015031	0.53	protein transport
GO:0032879	0.52	regulation of localization
GO:0071704	0.51	organic substance metabolic process
GO:0051049	0.51	regulation of transport
GO:0048518	0.51	positive regulation of biological process
GO:0044237	0.51	cellular metabolic process
GO:0032502	0.51	developmental process
GO:0050896	0.50	response to stimulus
GO:0044767	0.50	single-organism developmental process
GO:0044238	0.50	primary metabolic process
GO:0034613	0.50	cellular protein localization
GO:0006928	0.50	movement of cell or subcellular component

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0044424	0.99	intracellular part
GO:0044444	0.96	cytoplasmic part
GO:0043226	0.93	organelle
GO:0043227	0.91	membrane-bounded organelle
GO:0043229	0.90	intracellular organelle
GO:0043231	0.89	intracellular membrane-bounded organelle
GO:0016020	0.80	membrane
GO:0044422	0.74	organelle part
GO:0044446	0.73	intracellular organelle part
GO:0031982	0.65	vesicle
GO:0031988	0.62	membrane-bounded vesicle
GO:0005773	0.55	vacuole
GO:0031090	0.52	organelle membrane
GO:0005768	0.52	endosome
GO:0098588	0.51	bounding membrane of organelle
GO:0031410	0.51	cytoplasmic vesicle
GO:0005886	0.50	plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.483	2atxA	0.752	2.00	0.185	0.844	3.6.5.2	68
2	0.459	1aa9A	0.735	2.46	0.180	0.870	3.6.5.-	68
3	0.235	1m2oB	0.790	1.32	0.294	0.833	3.6.5.-	NA
4	0.067	1y80A	0.505	3.03	0.083	0.630	2.1.1.13	22
5	0.067	2c4wA	0.579	3.72	0.087	0.760	4.2.1.10	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.85	2j5xB	0.821	1.10	0.433	0.854	1.69	GSP	complex1.pdb.gz	22,23,24,25,26,27,28,41,43,44,67,123,124,126,127,157,158,159
2	0.08	1ksh0	0.822	1.17	0.396	0.854	1.45	III	complex2.pdb.gz	34,36,37,45,46,47,48,49,50,51,61,63,74,77,78
3	0.06	1m2o2	0.790	1.32	0.294	0.833	1.37	III	complex3.pdb.gz	22,23,27,31,38,39,41,42,43,44,45,46,47,48,49,50,51,63,70,73,74,78,81,159
4	0.06	2bcj3	0.772	2.17	0.274	0.875	1.12	III	complex4.pdb.gz	69,72,73,75,76,77,79,99,103,105,106,107,109,110,111,112
5	0.05	1fqj0	0.774	2.10	0.240	0.870	1.05	III	complex5.pdb.gz	69,72,75,76,77,79,80,102,103,106,107,110,112
6	0.05	1azt0	0.786	2.52	0.223	0.911	0.83	III	complex6.pdb.gz	55,137,141,145,150,151,152,165,166,170,173,177

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.