D-I-TASSER Q8N3J6

D-I-TASSER results for Q8N3J6

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q8N3J6
Protein Name: Cell adhesion molecule 2
Gene Name: CADM2

Input Sequence in FASTA format

>Q8N3J6 (435 residues)
MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPA
QQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTV
LGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRK
TFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQE
GQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATN
TIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALA
GQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINA
EGSQVNAEEKKEYFI

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q8N3J6-D1	1-360	360		MIWKRSAVLRFYSVCGLLLQGSQGQFPLTQNVTVVEGGTAILTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLSDEGQYTCSLFTMPVKTSKAYLTVLGVPEKPQISGFSSPVMEGDLMQLTCKTSGSKPAADIRWFKNDKEIKDVKYLKEEDANRKTFTVSSTLDFRVDRSDDGVAVICRVDHESLNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQPLILTCESKGKPLPEPVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLPTTIIPSLTTATVTTTVAITTSPTTSATTSSIRDPNALA
2	Q8N3J6-D2	361-435	75		GQNGPDHALIGGIVAVVVFVTLCSIFLLGRYLARHKGTYLTNEAKGAEDAPDADTAIINAEGSQVNAEEKKEYFI

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.52

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5zo1A	0.64	1.41	0.387	0.660	model1_5zo1A.pdb.gz
2	4fomA	0.57	3.11	0.225	0.655	model1_4fomA.pdb.gz
3	6efzA	0.56	2.67	0.245	0.623	model1_6efzA.pdb.gz
4	5uv6A	0.54	2.81	0.282	0.612	model1_5uv6A.pdb.gz
5	4ofyD	0.53	3.30	0.173	0.621	model1_4ofyD.pdb.gz
6	3alpA	0.53	3.88	0.226	0.641	model1_3alpA.pdb.gz
7	6efyA	0.52	3.51	0.184	0.609	model1_6efyA.pdb.gz
8	1dgiR	0.52	3.88	0.172	0.630	model1_1dgiR.pdb.gz
9	6dldA	0.51	3.61	0.269	0.607	model1_6dldA.pdb.gz
10	6dldB	0.50	2.54	0.250	0.552	model1_6dldB.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0042802	0.61	identical protein binding
GO:0004872	0.61	receptor activity
GO:0042803	0.52	protein homodimerization activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.93	single-organism process
GO:0009987	0.91	cellular process
GO:0044763	0.86	single-organism cellular process
GO:0065007	0.58	biological regulation
GO:0050789	0.56	regulation of biological process
GO:0007155	0.51	cell adhesion
GO:0008037	0.50	cell recognition

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.97	cell part
GO:0044425	0.70	membrane part
GO:0031224	0.63	intrinsic component of membrane
GO:0044459	0.62	plasma membrane part
GO:0016021	0.62	integral component of membrane
GO:0031226	0.56	intrinsic component of plasma membrane
GO:0044424	0.55	intracellular part
GO:0005887	0.55	integral component of plasma membrane
GO:0030054	0.50	cell junction

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2v5yA	0.405	5.71	0.071	0.593	3.1.3.48	150,213
2	0.060	2vkzG	0.303	7.78	0.028	0.540	2.3.1.38 3.1.2.14	157
3	0.060	2qf7A	0.341	7.31	0.038	0.586	6.4.1.1	NA
4	0.060	2uv8G	0.322	7.61	0.030	0.559	2.3.1.86	NA
5	0.060	2qf7B	0.353	7.60	0.041	0.618	6.4.1.1	315

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	3cmvE	0.309	7.31	0.026	0.515	0.11	ANP	complex1.pdb.gz	130,148,149
2	0.01	3cmxA	0.297	7.90	0.042	0.542	0.13	ALF	complex2.pdb.gz	132,136,219
3	0.01	3cmvE	0.309	7.31	0.026	0.515	0.21	ANP	complex3.pdb.gz	135,136,137,303
4	0.01	2omy1	0.173	3.11	0.090	0.198	0.12	III	complex4.pdb.gz	31,32,119
5	0.01	3cmvD	0.290	7.67	0.040	0.510	0.19	ANP	complex5.pdb.gz	133,144,145,146,149
6	0.01	3cmvD	0.290	7.67	0.040	0.510	0.15	ANP	complex6.pdb.gz	132,133,134
7	0.01	1bqu0	0.268	4.81	0.090	0.349	0.33	III	complex7.pdb.gz	92,100,154
8	0.01	3cmvG	0.288	6.95	0.028	0.471	0.19	ANP	complex8.pdb.gz	130,131,149
9	0.01	3cmvC	0.263	7.68	0.027	0.469	0.18	ANP	complex9.pdb.gz	131,146,170
10	0.01	1xmvA	0.170	7.03	0.059	0.281	0.18	ADP	complex10.pdb.gz	131,149,202

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.