D-I-TASSER Q86XS5

D-I-TASSER results for Q86XS5

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q86XS5
Protein Name: Angiopoietin-related protein 5
Gene Name: ANGPTL5

Input Sequence in FASTA format

>Q86XS5 (388 residues)
MMSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKED
CEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQVNELM
NRVLLLTTEVFRKQLDPFPHRPVQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFE
VMCDMDYRGGGRTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTS
FMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPF
STSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFSGKLLATGIQW
GTWTKNNSPVKIKSVSMKIRRMYNPYFK

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q86XS5-D1	1-142	142		MMSPSQASLLFLNVCIFICGEAVQGNCVHHSTDSSVVNIVEDGSNAKDESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQNSIVSYTRSTKKLLRNMMDEQQASLDYLSNQVNELMNRVLLLTTEVFRKQLDPFPHRP
2	Q86XS5-D2	143-388	246		VQSHGLDCTDIKDTIGSVTKTPSGLYIIHPEGSSYPFEVMCDMDYRGGGRTVIQKRIDGIIDFQRLWCDYLDGFGDLLGEFWLGLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFKMHLGRYSGNAGDAFRGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHNKTGWWFNECGLANLNGIHHFSGKLLATGIQWGTWTKNNSPVKIKSVSMKIRRMYNPYFK

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.52

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1m1jE	0.56	1.92	0.208	0.577	model1_1m1jE.pdb.gz
2	3ghgK	0.55	1.95	0.213	0.575	model1_3ghgK.pdb.gz
3	3ghgI	0.55	2.45	0.222	0.583	model1_3ghgI.pdb.gz
4	1ei3C	0.55	2.22	0.219	0.577	model1_1ei3C.pdb.gz
5	1lwuE	0.55	2.17	0.265	0.575	model1_1lwuE.pdb.gz
6	1n73C	0.54	1.62	0.288	0.559	model1_1n73C.pdb.gz
7	1jc9A	0.52	1.36	0.366	0.539	model1_1jc9A.pdb.gz
8	4m7fA	0.52	1.54	0.360	0.539	model1_4m7fA.pdb.gz
9	4epuA	0.52	1.57	0.377	0.539	model1_4epuA.pdb.gz
10	1z3uA	0.52	1.84	0.355	0.541	model1_1z3uA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005102	0.73	receptor binding
GO:0043167	0.66	ion binding
GO:0046872	0.64	metal ion binding
GO:0098772	0.62	molecular function regulator
GO:0097367	0.57	carbohydrate derivative binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.86	biological regulation
GO:0044699	0.85	single-organism process
GO:0050789	0.83	regulation of biological process
GO:0050794	0.79	regulation of cellular process
GO:0009987	0.77	cellular process
GO:0032502	0.72	developmental process
GO:0044763	0.69	single-organism cellular process
GO:0048518	0.67	positive regulation of biological process
GO:0044767	0.67	single-organism developmental process
GO:0048856	0.66	anatomical structure development
GO:0008152	0.66	metabolic process
GO:0071704	0.64	organic substance metabolic process
GO:0051239	0.64	regulation of multicellular organismal process
GO:0048523	0.64	negative regulation of cellular process
GO:0016043	0.64	cellular component organization
GO:0050896	0.62	response to stimulus
GO:0051240	0.60	positive regulation of multicellular organismal process
GO:0048522	0.60	positive regulation of cellular process
GO:0043170	0.60	macromolecule metabolic process
GO:0019222	0.60	regulation of metabolic process
GO:0080090	0.59	regulation of primary metabolic process
GO:0060255	0.58	regulation of macromolecule metabolic process
GO:0048583	0.58	regulation of response to stimulus
GO:0032501	0.58	multicellular organismal process
GO:0007165	0.58	signal transduction
GO:0031323	0.57	regulation of cellular metabolic process
GO:0022607	0.55	cellular component assembly
GO:0060548	0.54	negative regulation of cell death
GO:0051241	0.54	negative regulation of multicellular organismal process
GO:0050790	0.54	regulation of catalytic activity
GO:0044707	0.54	single-multicellular organism process
GO:0044238	0.54	primary metabolic process
GO:0042981	0.54	regulation of apoptotic process
GO:0032879	0.54	regulation of localization
GO:0009893	0.54	positive regulation of metabolic process
GO:0071822	0.53	protein complex subunit organization
GO:0048513	0.53	animal organ development
GO:0044237	0.53	cellular metabolic process
GO:0032268	0.53	regulation of cellular protein metabolic process
GO:0010604	0.53	positive regulation of macromolecule metabolic process
GO:0065008	0.52	regulation of biological quality
GO:0031325	0.52	positive regulation of cellular metabolic process
GO:0007166	0.52	cell surface receptor signaling pathway
GO:0006461	0.52	protein complex assembly
GO:0001932	0.52	regulation of protein phosphorylation
GO:1902531	0.51	regulation of intracellular signal transduction
GO:0051128	0.51	regulation of cellular component organization
GO:0006928	0.51	movement of cell or subcellular component
GO:0051130	0.50	positive regulation of cellular component organization
GO:0051050	0.50	positive regulation of transport
GO:0048731	0.50	system development
GO:0043623	0.50	cellular protein complex assembly
GO:0032880	0.50	regulation of protein localization
GO:0006950	0.50	response to stress
GO:0002376	0.50	immune system process
GO:0001934	0.50	positive regulation of protein phosphorylation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044421	0.93	extracellular region part
GO:0005576	0.88	extracellular region
GO:0044464	0.85	cell part
GO:0032991	0.74	macromolecular complex
GO:0043234	0.73	protein complex
GO:0043227	0.68	membrane-bounded organelle
GO:0016020	0.64	membrane
GO:0044424	0.61	intracellular part
GO:0005615	0.58	extracellular space
GO:0031982	0.54	vesicle
GO:0070062	0.52	extracellular exosome

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2hb6B	0.272	6.85	0.073	0.446	3.4.11.1	152
2	0.060	1aozA	0.285	7.25	0.040	0.495	1.10.3.3	NA
3	0.060	1qo9A	0.289	6.96	0.045	0.492	3.1.1.7	NA
4	0.060	2o1xB	0.286	6.88	0.050	0.479	2.2.1.7	NA
5	0.060	1c9uB	0.281	6.07	0.035	0.436	1.1.5.2 1.1.99.17	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.07	1z3uC	0.517	1.66	0.352	0.539	0.65	CA	complex1.pdb.gz	184,188,190
2	0.05	1ficA	0.544	1.76	0.358	0.567	0.69	CA	complex2.pdb.gz	166,168,180,181
3	0.04	1fzgC	0.543	1.63	0.306	0.564	0.67	CA	complex3.pdb.gz	218,221,222
4	0.04	1fzbC	0.546	1.81	0.287	0.570	0.76	CA	complex4.pdb.gz	184,186,188,189,190,191
5	0.03	1m1jC	0.545	2.17	0.224	0.575	0.70	CA	complex5.pdb.gz	184,186,190,191

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.