D-I-TASSER results for Q86WG3-D1

Input Sequence in FASTA format

>Q86WG3 (371 residues)
MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKR
KTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWED
DTPVATAKNMPGDSADLFGDGTTEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTH
GGYYGEGLNAIIVFAACFLPDSSLPDYHYIMENLFLYVISSLELLVAEDYMIVYLNGATP
RRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTVLAISRPFISVKFINKIQYVH
SLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSA
LVSEDQETSMS

Predicted Secondary Structure

                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |
Sequence
MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGDGTTEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTHGGYYGEGLNAIIVFAACFLPDSSLPDYHYIMENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTVLAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETSMS
Prediction
CCCCHHHHHCCCCSSHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCHHHHCCCCCCCCCCCCCCCHHHCCCCCCCHHHHCCCCCCSSSCCCCHHHCCCCHHHHHHHHHHHSSCCSCCCCCCSSSSSSCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCSSSSSSCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCSSSSSCCCHHHHHHHHHHHHHCCHHHHCSSSSSCCHHHHHHHCCHHHCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Confidence
98523432205712124323444788886444422277777888899987666886544323468876666788999867766667763234443334666541123313676201101333334445666412212454421001103410111101501320113567777751331155407999579999610278434411455499999999999754337987999976998756798799999999995699997641789985948999999998422463344127771999999985684123698899999998723456666888765578877777533456544446677667789

H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |
Sequence
MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGDGTTEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTHGGYYGEGLNAIIVFAACFLPDSSLPDYHYIMENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTVLAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETSMS
Prediction
87365041316615244413767122525255326535452745734244252555552444133372425156555344445435455514252542644544642533454442416542543655644554444245442444455544414412246534424353145024003210234452100000002101455354242213200210041045116440000000000335321213002100410252035001000000002111000300210134402400210630530262043621510610251055116565443424354342544634532516455131455563548

Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Contact, Hydrogen and Distance Map Used in D-I-TASSER simulation

D-I-TASSER simulation is guided by the consensus contact map (left figure), distance map (middle figure) and Hydrogen bond network (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Top 10 threading templates used by D-I-TASSER

Rank	PDB hit	ID1	ID2	Cov	Norm. Zscore	Download alignment		20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                 260                 280                 300                 320                 340                 360                    |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |
							SS	CCCCHHHHHCCCCSSHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHCCCCCHHHHCCCCCCCCCCCCCCCHHHCCCCCCCHHHHCCCCCCSSSCCCCHHHCCCCHHHHHHHHHHHSSCCSCCCCCCSSSSSSCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCSSSSSSCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCSSSSSCCCHHHHHHHHHHHHHCCHHHHCSSSSSCCHHHHHHHCCHHHCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
							Seq	MGTTEATLRMENVDVKEEWQDEDLPRPLPEETGVELLGSPVEDTSSPPNTLNFNGAHRKRKTLVAPEINISLDQSEGSLLSDDFLDTPDDLDINVDDIETPDETDSLEFLGNGNELEWEDDTPVATAKNMPGDSADLFGDGTTEDGSAANGRLWRTVIIGEQEHRIDLHMIRPYMKVVTHGGYYGEGLNAIIVFAACFLPDSSLPDYHYIMENLFLYVISSLELLVAEDYMIVYLNGATPRRRMPGIGWLKKCYQMIDRRLRKNLKSLIIVHPSWFIRTVLAISRPFISVKFINKIQYVHSLEDLEQLIPMEHVQIPDCVLQYEEERLKARRESARPQPEFVLPRSEEKPEVAPVENRSALVSEDQETSMS
1	2d4qA1	0.16	0.07	2.23	1.02	FFAS-3D		----------------------------------------------------------------------------------------------------------------------------------------------------------------------EFKALK-TLSIFYQAGTSKAG-NPIFYYVARRFKTGQIN-----GDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKSKRLVFIDCPGKLAEHIEHEQQKLPAATLALEED---------------------------------------------
2	2e2xA	0.16	0.06	2.14	1.15	CNFpred		--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IFYQAGTSK-AGNPIFYYVARRFKTGQ-----INGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKSKRLVFIDCPGKLAEHIEHEQQKLPAATLALEEDLKV------------------------------------------
3	7e0wA	0.24	0.10	3.02	3.14	HHsearch		--------------------------------------------------------------------------------------------------------------------------------------------------------------------GPEFE--HDLERLCFIGGYDNDN-DKVIVVVTKNLELFKKYD----DINLIKEAYNHVHKLIQKDYTAVFFAHDS--TVFSYLGLSLKAYYGMDYYLHKNVKAVYVIHTDWMSKVAIRTLLSIASPKFTRKFRYLNSISDLNKYIPLSHLKLPPIVYE-------------------------------------------------
4	6w32B	0.09	0.07	2.63	0.62	CEthreader		----------------------------------------------------------------------------MKFDNDSEKQVFDKLKKAIPGIIKEKCAGYDELYGYKLNPQEEVDKYYDEKIADRLTYKLCKAYQFEYSTIVQNLIDILNWEFNPLSCAYKEVHNTELQNVGILTFDANGDANKKAVTWNLYGQLVKKKELFQNVDKFVRYRIGLMEKGLNNYMTQVHDYKGVSVWRMDIKNCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVVLTDGSKLGQYLKDCPYEGYGGKDKKNNLTKQNVTNVHPTEYGLYILQKQIIED--------------------
5	2ygrA	0.07	0.06	2.62	0.73	EigenThreader		SRVRVDVHPLTDPPRARRQEKHDKLACPNGHALAVDDLEPRSFSFNSPYGACPDCSGLGIRKVDPELVVPDPDRTLAQGAVAPGFDVDTPWRKLPAKARKAILEGADEQVHVRYRNRYGRTRSYYADFEGVSEQPCPVCAGTRLKPEILAVEHG------------AKSIAEVCELSIADCADFLNALTL----GGLEYLSLSRAAATLSGGEAQRIRLATQIGSGLVGVLYVLDEPS-----IGLHQRDNRRLIETLTRLRDLGNTLIVVEHDEDTIEHDELLRNKDSITGAYLSGRDILAAVLANRLNGARQVPGDKIRTLFAATNEAKVRGYKPGRFSFNVKGGRCEACTGDGVCQGARYNRETLEVH
6	7e0wA	0.24	0.09	2.94	1.02	FFAS-3D		------------------------------------------------------------------------------------------------------------------------------------------------------------------------EFEHDLERLCFIGGYDNDN-DKVIVVVTKNLELFKKYDD----INLIKEAYNHVHKLIQKRYTAVFFAHDS--TVFSYLGLSLKAYYGMDYYLHKNVKAVYVIHTDWMSKVAIRTLLSIASPKFTRKFRYLNSISDLNKYIPLSHLKLPPIVYE-------------------------------------------------
7	6w32B2	0.10	0.05	1.81	0.85	SPARKS-K		-----------------------------------------------------------------------------------------------------------------------------------------------------------NPLSCAYKEVHN-TELQNVGILTFDANGDANKK-AVTWNLYGQLVKKKELFQN--VDKFVRYRIGLMEKGLSLYMTQVHDYKGVSVWRMDIKNCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVVLTDGSKLGQYLK----DCPY------EGYGNNLTKQNVTNVHPTEYGLYILQKQIIED---------------
8	3p7zA	0.16	0.06	2.07	1.04	CNFpred		--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IFYQAGTSK-AGNPVFYYVARRFKTGQ-----INGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKSKRLVFIDCPGKLAEHIEHEQQKLPAATLALEEDLKVF-----------------------------------------
9	6mu1A	0.06	0.05	1.97	0.83	DEthreader		-----------QVTPVKYARLWSQDNYQIKDLDRLSKLLINFLNPGLSEIN---------MMAELVGEV-V--------IHLVELLAVCTEGKNVYT-----------------------------CI-VLQTLREMAS-LVDLMNAFESILAFMAQIKATVVIIMQPILRFLQLLCEN--------------LQNFLRCQNNKTNYNLVCETLQFLDCCKNVALINQ-LELTCGPCHENQNCITHESNGIDIITALILNDIVLKNSKLAESRHDSNAERILYNMRPKVEVGIYILHQLR------AQI------I--VRLDRTMEQ---DEQGSKID-K-TRNGIITAAALIVY-SIYLFKDDFIET---
10	1oizA	0.07	0.04	1.76	0.95	MapAlign		------------------------------------------------------------------------------------------------------------AGPQLNALPDHSPLLQPGLAALRRRAREAGVPLAPLPLTDSFLLRFLARDFDLDLAWLLRSIIGLLKAGYHGVLSRDPTGSKVLIYRIAHWDPK-----VFTAYDVFRVSLITSELIVRNGIKAIFDLEGWQFSHAITPSVAKKIAAVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGYKQSLLQHFLPLEYGGEEFSMEDICQEWTNFIM--------------------------------------


(a) ID1 is the number of template residues identical to query divided by number of aligned residues.
(b) ID2 is the number of template residues identical to query divided by query sequence length.
(c) Cov is equal the number of aligned template residues divided by query sequence length.
(d) Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold.
(e) Download alignment lists the threading program used to identify the template, and provide the 3D structure of aligned regions of threading templates (threading[1-10].pdb.gz).
(f) Template residues identical to query sequence are highlighted in color.

Top 1 final models from D-I-TASSER

Rank^a	Estimated TM-score^b
1	0.6124


(a) D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.
(b) The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)


Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.
1	6mu1A	0.46	6.19	0.056	0.714
2	5u1sA	0.44	6.47	0.038	0.706
3	3javA	0.42	7.15	0.047	0.736
4	6yejA	0.42	7.03	0.059	0.722
5	6g2dC	0.42	6.44	0.039	0.668
6	5gquA	0.41	5.77	0.056	0.607
7	6af0A	0.40	6.80	0.064	0.666
8	5vchA	0.40	6.23	0.034	0.615
9	3pffA	0.40	5.11	0.047	0.550
10	7alpU2	0.39	6.30	0.047	0.617



(a) Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b) Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c) RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d) IDEN^a is the percentage sequence identity in the structurally aligned region.
(e) Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)


GO term	Cscore^GO	Name
GO:0042802	0.77	identical protein binding






(a) Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.
(b) The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

Biological Process (BP)


GO term	Cscore^GO	Name
GO:0044699	0.93	single-organism process
GO:0009987	0.92	cellular process
GO:0044763	0.89	single-organism cellular process
GO:0008219	0.84	cell death
GO:0006915	0.83	apoptotic process






(a) Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.
(b) The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

Cellular Component (CC)


GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0044444	0.86	cytoplasmic part
GO:0005829	0.61	cytosol






(a) Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.
(b) The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB


Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1z0hB	0.234	6.65	0.020	0.388	3.4.24.69	217
2	0.060	2qf7B	0.346	6.27	0.058	0.528	6.4.1.1	NA
3	0.060	2np0A	0.376	7.38	0.049	0.679	3.4.24.69	NA
4	0.060	3m07A	0.356	6.16	0.041	0.539	3.2.1.141	NA
5	0.060	2w00B	0.360	6.79	0.042	0.607	3.1.21.3	NA



(a) Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b) TM-score is a measure of global structural similarity between query and template protein.
(c) RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d) IDEN^a is the percentage sequence identity in the structurally aligned region.
(e) Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:


Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Predicted binding site residues
1	0.01	3b74A	0.386	4.05	0.069	0.488	0.57	PEE	178,191,195,212,216,220,224,230,231,233,246,249,250,265



(a) Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b) BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c) TM-score is a measure of global structural similarity between query and template protein.
(d) RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e) IDEN^a is the percentage sequence identity in the structurally aligned region.
(f) Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

References:
1. Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.