D-I-TASSER results for Q7Z2X4-D1

Input Sequence in FASTA format

>Q7Z2X4 (250 residues)
MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKK
EPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWK
KHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIF
AWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEE
VSQELESDDG

Predicted Secondary Structure

                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |
Sequence
MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
Prediction
CCCCCCCCCCCCCCCCCCHHHCCCCCHHHHCCCCSSSCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCSSCCCCCCCCCCCCCSSSSSSSSCCSSCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCSSSSSSSCCSSSSSSCCCCCCCCCCSSSSSSSSSSSSCCCCCCCCCSSSSSSSSCCCCCCCSSSSSSSSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCC
Confidence
9777656644455443540112443202212110221256764246778888875335556587644467521014678853346651246889971122024577665189999999999731345665532799994572899845666553222357874124422489877983899999706777753167899996798999999999999999999999986677750326888987521479

H:Helix; S:Strand; C:Coil

Predicted Solvent Accessibility

                  20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240
                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |
Sequence
MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
Prediction
7252414120044122024411553541563541414432443414410442042132455222522154455161345434444443231303200433244154342104400440154154547624344030302343030233745564443033020330100113661332000000223376253303010000536630440031014104400540464543555554553455346788

Values range from 0 (buried residue) to 8 (highly exposed residue)

Predicted Contact, Hydrogen and Distance Map Used in D-I-TASSER simulation

D-I-TASSER simulation is guided by the consensus contact map (left figure), distance map (middle figure) and Hydrogen bond network (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Top 10 threading templates used by D-I-TASSER

Rank	PDB hit	ID1	ID2	Cov	Norm. Zscore	Download alignment		20                  40                  60                  80                 100                 120                 140                 160                 180                 200                 220                 240                    |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |                   |
							SS	CCCCCCCCCCCCCCCCCCHHHCCCCCHHHHCCCCSSSCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCCSSCCCCCCCCCCCCCSSSSSSSSCCSSCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCSSSSSSSCCSSSSSSCCCCCCCCCCSSSSSSSSSSSSCCCCCCCCCSSSSSSSSCCCCCCCSSSSSSSSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCC
							Seq	MFSLPLSLPLCEDTAFLPSKCCSSHKTIKQARTLIMIFLASGTHFQTMLKSKLNVLTLKKEPLPAVIFHEPEAIELCTTTPLMKTRTHSGCKVTYLGKVSTTGMQFLSGCTEKPVIELWKKHTLAREDVFPANALLEIRPFQVWLHHLDHKGEATVHMDTFQVARIAYCTADHNVSPNIFAWVYREINDDLSYQMDCHAVECESKLEAKKLAHAMMEAFRKTFHSMKSDGRIHSNSSSEEVSQELESDDG
1	6l30A	0.10	0.07	2.69	0.83	DEthreader		---------KARRFYAAVDDEEGQGPILAPEIKTIFGSIIYVRPVQRLPSVALLLNDKEIGSKEVMTHI----N--EDKRKEAQQSLVQRVETISLGEHP----------------------------DRGEQVTLFLFNDCLEIARKRHP-ASLKHIHLMPLSQIKVLDIRETDCHNAFALLVRPPTE--Q-ANVLLSFQMTS-DELPK-ENWLKMLCRHVANTIC----K--------A--DAENLI-
2	3so6A	0.18	0.10	3.14	1.73	SPARKS-K		-------------------------------------------------------------------------------------MEGMVFSLKYLGMTLVERP-KGEELSAAAVKRIVATAKASGKK--LQKVTLKVSPRGIILTDSLTSQ----LIENVSIYRISYCTADKM-HDKVFAYIAQSQQNES---LECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR-----------------
3	3so6A	0.18	0.10	3.14	1.05	MapAlign		-------------------------------------------------------------------------------------MEGMVFSLKYLGMTLVERP-KGEELSAAAVKRIVATA--KASGKKLQKVTLKVSPRGIILTDSL----TSQLIENVSIYRISYCTAD-KMHDKVFAYIAQSQ---QNESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR-----------------
4	2m38A	0.13	0.07	2.37	0.90	CEthreader		---------------------------------------------------------------------------------EKLIAQSCDYKAAYLGSMLIKE-LRGTESTQDACAKMRANCQKTEQMKKVPTIILSVSAKGVKFIDAT----NKNIIAEHEIRNISCAAQD-PEDLSTFAYITKDLK---SNHHYCHVFTAFDVNLAAEIILTLGQAFEVAYQ--------------------------
5	3so6A	0.18	0.10	3.14	1.26	MUSTER		-------------------------------------------------------------------------------------MEGMVFSLKYLGMTLVERPK-GEELSAAAVKRIVATAKASGK--KLQKVTLKVSPRGIILTDSLTS----QLIENVSIYRISYCTADKM-HDKVFAYIAQSQQNES---LECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR-----------------
6	6ituA	0.17	0.10	3.28	2.78	HHsearch		--------------------------------------------------------------------HTPEAL----------SKHFIPYNAKFLGSTEVEQP-KGTEVVRDAVRKLKFARHIKSEGQKIPKVELQISIYGVKILEPK----TKEVQHNCQLHRISFCADDK-TDKRIFTFICKDSES---NKHLCYVFDSEK--CAEEITLTIGQAFDLAYRKFLESGGKDV----------------
7	3so6A	0.18	0.10	3.14	1.30	FFAS-3D		--------------------------------------------------------------------------------------EGMVFSLKYLGMTLVERPKGEE-LSAAAVKRIVATAK--ASGKKLQKVTLKVSPRGIILTDSLTSQ----LIENVSIYRISYCTAD-KMHDKVFAYIAQSQQNES---LECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR-----------------
8	2yszA	0.15	0.10	3.23	0.92	EigenThreader		-------------------------------------------------------------------GSSG------SSGPTPKTELVQKFRVQYLGMLPVRPV--GMDTLNSAIENLMTSS----SKEDWPSVNMNVADATVTVISEK---NEEEVLVECRVRFLSFMGVG--KDVHTFAFIMDT----GNQRFECHVFWCEPN--AANVSEAVQAACSGPSSGGSSGSSGSSGSSGERHLSKMQQNGY
9	3so6A	0.18	0.10	3.14	1.83	CNFpred		-------------------------------------------------------------------------------------MEGMVFSLKYLGMTLVERP-KGEELSAAAVKRIVATAKAS--GKKLQKVTLKVSPRGIILTDSL----TSQLIENVSIYRISYCTADK-MHDKVFAYIAQSQQ---NESLECHAFLCTKRKVAQAVTLTVAQAFKVAFEFWQVSLVPR-----------------
10	6ituA	0.15	0.08	2.83	0.83	DEthreader		---------------------------------------------------------------------------------EALSKHFIPYNAKFLGSTEV-EQPKGTEVVRDAVRKLKFARHIKKSGQKIPKVELQISIYGVKILEP-K---TKEVQHNCQLHRISFCADDKT-DKRIFTFICKDSE---SNKHLCYVFDSEK--CAEEITLTIGQAFDLAYRKFLESGGKD-----------------


(a) ID1 is the number of template residues identical to query divided by number of aligned residues.
(b) ID2 is the number of template residues identical to query divided by query sequence length.
(c) Cov is equal the number of aligned template residues divided by query sequence length.
(d) Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold.
(e) Download alignment lists the threading program used to identify the template, and provide the 3D structure of aligned regions of threading templates (threading[1-10].pdb.gz).
(f) Template residues identical to query sequence are highlighted in color.

Top 1 final models from D-I-TASSER

Rank^a	Estimated TM-score^b
1	0.6505


(a) D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.
(b) The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)


Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.
1	6ituA	0.55	1.52	0.153	0.576
2	1ntvA	0.53	2.04	0.109	0.572
3	1m7eA	0.52	2.26	0.124	0.572
4	3so6A	0.52	1.47	0.175	0.544
5	3suzA	0.51	2.89	0.171	0.592
6	1wj1A	0.51	2.61	0.141	0.580
7	2m38A	0.47	2.33	0.127	0.524
8	3d8dA	0.45	2.27	0.186	0.500
9	1n3hA	0.45	3.91	0.100	0.580
10	5evmA1	0.28	5.98	0.043	0.476



(a) Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b) Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c) RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d) IDEN^a is the percentage sequence identity in the structurally aligned region.
(e) Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)


GO term	Cscore^GO	Name
GO:0046332	0.07	SMAD binding
GO:0043548	0.07	phosphatidylinositol 3-kinase binding
GO:0043422	0.07	protein kinase B binding
GO:0042802	0.07	identical protein binding
GO:0042169	0.07	SH2 domain binding
GO:0038024	0.07	cargo receptor activity
GO:0035615	0.07	clathrin adaptor activity
GO:0035612	0.07	AP-2 adaptor complex binding
GO:0008134	0.07	transcription factor binding
GO:0008022	0.07	protein C-terminus binding
GO:0005546	0.07	phosphatidylinositol-4,5-bisphosphate binding
GO:0005178	0.07	integrin binding
GO:0001540	0.07	beta-amyloid binding






(a) Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.
(b) The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

Biological Process (BP)


GO term	Cscore^GO	Name
GO:0007155	0.99	cell adhesion
GO:0045944	0.86	positive regulation of transcription from RNA polymerase II promoter
GO:0001933	0.86	negative regulation of protein phosphorylation
GO:0032502	0.81	developmental process
GO:2001274	0.67	negative regulation of glucose import in response to insulin stimulus
GO:2001171	0.67	positive regulation of ATP biosynthetic process
GO:2001170	0.67	negative regulation of ATP biosynthetic process
GO:2000379	0.67	positive regulation of reactive oxygen species metabolic process
GO:2000045	0.67	regulation of G1/S transition of mitotic cell cycle
GO:0090298	0.67	negative regulation of mitochondrial DNA replication
GO:0090005	0.67	negative regulation of establishment of protein localization to plasma membrane
GO:0071398	0.67	cellular response to fatty acid
GO:0071356	0.67	cellular response to tumor necrosis factor
GO:0071354	0.67	cellular response to interleukin-6
GO:0070584	0.67	mitochondrion morphogenesis
GO:0070346	0.67	positive regulation of fat cell proliferation
GO:0051881	0.67	regulation of mitochondrial membrane potential
GO:0046627	0.67	negative regulation of insulin receptor signaling pathway






(a) Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.
(b) The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

Cellular Component (CC)


GO term	Cscore^GO	Name
GO:0005654	1.00	nucleoplasm
GO:0031225	0.99	anchored component of membrane
GO:0005737	0.78	cytoplasm






(a) Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.
(b) The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB


Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1p6sA	0.333	2.93	0.097	0.400	2.7.11.1	NA
2	0.060	1dl2A	0.381	5.97	0.026	0.652	3.2.1.113	NA
3	0.060	1bakA	0.349	3.39	0.077	0.432	2.7.11.15	166
4	0.060	3d9dA	0.368	6.08	0.056	0.632	1.7.3.1	NA
5	0.060	1nx9A	0.388	6.24	0.053	0.680	3.1.1.43	NA



(a) Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b) TM-score is a measure of global structural similarity between query and template protein.
(c) RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d) IDEN^a is the percentage sequence identity in the structurally aligned region.
(e) Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:


Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Predicted binding site residues
1	0.01	2l1cA	0.477	4.09	0.141	0.616	0.23	III	164,165,166,167,168,169,170,171,185,195,215,216
2	0.01	2yajA	0.398	5.83	0.024	0.664	0.17	4HP	16,74,213,215
3	0.01	2bcj4	0.424	4.24	0.050	0.564	0.15	III	218,219,222,223
4	0.01	3pvuA	0.319	6.60	0.033	0.588	0.18	QRW	97,133,204
5	0.01	3krwA	0.316	6.42	0.047	0.576	0.16	BA1	97,99,185,186,187



(a) Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b) BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c) TM-score is a measure of global structural similarity between query and template protein.
(d) RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e) IDEN^a is the percentage sequence identity in the structurally aligned region.
(f) Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

References:
1. Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.