D-I-TASSER Q6NXP0

D-I-TASSER results for Q6NXP0

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q6NXP0
Protein Name: EF-hand calcium-binding domain-containing protein 12
Gene Name: EFCAB12

Input Sequence in FASTA format

>Q6NXP0 (572 residues)
MDDDYEAYHSLFLSLLGLCPSKTPINENAPVFDPEPVIAHCFKQFQQKDFRLPQTRRRII
MVPRKEDQTPLNPASQPQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFG
DVKRWLENKPSITPSEAKVLHMIHEEQSAQPNASQATTRTTRKKAPRLSRLSRQMVPQLQ
LPEPPALSVMYSYLHSRKIKILEIFHKVGQGENQRITREEFIAAVKAVGVPLKNQEVEDI
VIYLSSLGKHNTITMDILANTYKQWSMAQQRSSLATAREHYILAKHRDSLKGPLKKQEVD
SAPQLPKVDLLTVPAVDTQMETRPMTLEEMEEVGKRYRERQRQHKLTIPSIQYTEQCHLV
RCGNRHFDEHCLPSTIHGDMRELIDSARRHNFLVYLQCWKLCKSYGLPLTEDILMKALLY
PGDKIIFQMDKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFK
EFEEFTRKLKVKRSSGLQQTHPNSFWPGHLLDKLQLYLPTVATDRSLALFSCVQHQPHVY
PATYHPDHWWPLRNKNYMTHAHYDAAKVYYIN

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q6NXP0-D1	1-572	572		MDDDYEAYHSLFLSLLGLCPSKTPINENAPVFDPEPVIAHCFKQFQQKDFRLPQTRRRIIMVPRKEDQTPLNPASQPQAPPKPIPSFKVLEARDIQEQPEDRKTWLSQRSKLRQELESFGDVKRWLENKPSITPSEAKVLHMIHEEQSAQPNASQATTRTTRKKAPRLSRLSRQMVPQLQLPEPPALSVMYSYLHSRKIKILEIFHKVGQGENQRITREEFIAAVKAVGVPLKNQEVEDIVIYLSSLGKHNTITMDILANTYKQWSMAQQRSSLATAREHYILAKHRDSLKGPLKKQEVDSAPQLPKVDLLTVPAVDTQMETRPMTLEEMEEVGKRYRERQRQHKLTIPSIQYTEQCHLVRCGNRHFDEHCLPSTIHGDMRELIDSARRHNFLVYLQCWKLCKSYGLPLTEDILMKALLYPGDKIIFQMDKVCPIRQPGGYYSDWKVFSPNLALLRSQGPGKSKRTDKKTPKKSKKMRFKEFEEFTRKLKVKRSSGLQQTHPNSFWPGHLLDKLQLYLPTVATDRSLALFSCVQHQPHVYPATYHPDHWWPLRNKNYMTHAHYDAAKVYYIN

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.5075

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5xjyA	0.37	7.24	0.046	0.575	model1_5xjyA.pdb.gz
2	7cpxA	0.35	7.60	0.020	0.561	model1_7cpxA.pdb.gz
3	7lkpA	0.32	7.04	0.063	0.493	model1_7lkpA.pdb.gz
4	6rw8A	0.32	7.58	0.047	0.517	model1_6rw8A.pdb.gz
5	6r9tA	0.32	7.19	0.035	0.489	model1_6r9tA.pdb.gz
6	5x7oA	0.30	7.69	0.043	0.493	model1_5x7oA.pdb.gz
7	6ar6A	0.29	7.58	0.050	0.465	model1_6ar6A.pdb.gz
8	6ez8A	0.29	7.60	0.031	0.462	model1_6ez8A.pdb.gz
9	5cskA	0.29	8.03	0.041	0.470	model1_5cskA.pdb.gz
10	7bwmA	0.28	7.38	0.033	0.441	model1_7bwmA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0043169	0.65	cation binding
GO:1901363	0.64	heterocyclic compound binding
GO:0097159	0.64	organic cyclic compound binding
GO:0035639	0.52	purine ribonucleoside triphosphate binding
GO:0032559	0.52	adenyl ribonucleotide binding
GO:0032550	0.52	purine ribonucleoside binding
GO:0016879	0.52	ligase activity, forming carbon-nitrogen bonds

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.94	cellular process
GO:0065007	0.91	biological regulation
GO:0050789	0.91	regulation of biological process
GO:0050794	0.90	regulation of cellular process
GO:0071704	0.86	organic substance metabolic process
GO:0044238	0.86	primary metabolic process
GO:0044237	0.85	cellular metabolic process
GO:0044260	0.83	cellular macromolecule metabolic process
GO:0044267	0.80	cellular protein metabolic process
GO:0007165	0.74	signal transduction
GO:0006796	0.72	phosphate-containing compound metabolic process
GO:0006464	0.72	cellular protein modification process
GO:0046777	0.71	protein autophosphorylation
GO:0018193	0.71	peptidyl-amino acid modification
GO:0035556	0.68	intracellular signal transduction
GO:0018105	0.66	peptidyl-serine phosphorylation
GO:0009738	0.63	abscisic acid-activated signaling pathway
GO:0051128	0.52	regulation of cellular component organization
GO:0048522	0.52	positive regulation of cellular process
GO:0051130	0.51	positive regulation of cellular component organization

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0043226	0.95	organelle
GO:0043229	0.94	intracellular organelle
GO:0043231	0.92	intracellular membrane-bounded organelle
GO:0005737	0.92	cytoplasm
GO:0044444	0.91	cytoplasmic part
GO:0016020	0.88	membrane
GO:0005634	0.81	nucleus
GO:0044422	0.72	organelle part
GO:0044446	0.69	intracellular organelle part
GO:0005886	0.55	plasma membrane

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1qxpB	0.244	6.86	0.026	0.367	3.4.22.53 3.4.22.52	NA
2	0.060	3ikmD	0.250	7.66	0.033	0.397	2.7.7.7	NA
3	0.060	2cseW	0.241	7.43	0.043	0.379	3.6.4.13	NA
4	0.060	2pziA	0.240	8.43	0.051	0.425	2.7.11.1	NA
5	0.060	2hb6B	0.236	6.95	0.039	0.360	3.4.11.1	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	1l0l5	0.119	5.30	0.065	0.157	0.60	III	complex1.pdb.gz	230,231,232,234,235,242,246
2	0.01	2q1fB	0.252	7.28	0.017	0.390	0.44	CA	complex2.pdb.gz	248,249,250
3	0.01	1hnz2	0.077	4.03	0.011	0.093	0.41	III	complex3.pdb.gz	202,203,206,212,213
4	0.01	2vjt3	0.114	5.64	0.040	0.154	0.62	III	complex4.pdb.gz	190,201,217,218,219,221,222,225
5	0.01	2yu91	0.047	3.25	0.081	0.052	0.44	III	complex5.pdb.gz	198,199,204,205,206,209,210

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.