D-I-TASSER Q5GAN3

D-I-TASSER results for Q5GAN3

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q5GAN3
Protein Name: Probable inactive ribonuclease-like protein 13
Gene Name: RNASE13

Input Sequence in FASTA format

>Q5GAN3 (156 residues)
MAPAVTRLLFLQLVLGPTLVMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMR
GKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSHQQPP
TSCYYNSTLTNQKLYLLCSRKYEADPIGIAGLYSGI

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q5GAN3-D1	1-156	156		MAPAVTRLLFLQLVLGPTLVMDIKMQIGSRNFYTLSIDYPRVNYPKGFRGYCNGLMSYMRGKMQNSDCPKIHYVIHAPWKAIQKFCKYSDSFCENYNEYCTLTQDSLPITVCSLSHQQPPTSCYYNSTLTNQKLYLLCSRKYEADPIGIAGLYSGI

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.7032

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	3mwqA	0.78	1.00	0.189	0.814	model1_3mwqA.pdb.gz
2	1rraA	0.75	1.25	0.202	0.795	model1_1rraA.pdb.gz
3	1k2aA	0.72	1.90	0.171	0.788	model1_1k2aA.pdb.gz
4	2rnfA	0.71	1.69	0.183	0.769	model1_2rnfA.pdb.gz
5	1qmtA	0.71	1.78	0.138	0.788	model1_1qmtA.pdb.gz
6	2zpoA	0.69	1.77	0.222	0.750	model1_2zpoA.pdb.gz
7	2vq9A	0.67	1.94	0.162	0.750	model1_2vq9A.pdb.gz
8	2j4tA	0.67	2.08	0.207	0.744	model1_2j4tA.pdb.gz
9	1k59A	0.66	1.89	0.195	0.731	model1_1k59A.pdb.gz
10	2hkyA	0.66	2.28	0.167	0.769	model1_2hkyA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004540	1.00	ribonuclease activity
GO:0004519	0.97	endonuclease activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.91	biological regulation
GO:0044699	0.90	single-organism process
GO:0009987	0.90	cellular process
GO:0050789	0.89	regulation of biological process
GO:0016070	0.88	RNA metabolic process
GO:0050896	0.84	response to stimulus
GO:0006950	0.83	response to stress
GO:0050794	0.80	regulation of cellular process
GO:0044767	0.80	single-organism developmental process
GO:0048646	0.78	anatomical structure formation involved in morphogenesis
GO:0048522	0.76	positive regulation of cellular process
GO:0044763	0.76	single-organism cellular process
GO:0048519	0.74	negative regulation of biological process
GO:0032879	0.74	regulation of localization
GO:0001525	0.68	angiogenesis
GO:0051222	0.61	positive regulation of protein transport
GO:0016043	0.61	cellular component organization
GO:0008284	0.61	positive regulation of cell proliferation
GO:0050714	0.59	positive regulation of protein secretion
GO:0048662	0.59	negative regulation of smooth muscle cell proliferation
GO:0032431	0.59	activation of phospholipase A2 activity
GO:0030041	0.59	actin filament polymerization
GO:0009303	0.59	rRNA transcription
GO:0007202	0.59	activation of phospholipase C activity
GO:0006651	0.59	diacylglycerol biosynthetic process
GO:0001938	0.59	positive regulation of endothelial cell proliferation
GO:0001666	0.59	response to hypoxia

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	0.97	intracellular part
GO:0043227	0.95	membrane-bounded organelle
GO:0005576	0.93	extracellular region
GO:0044421	0.88	extracellular region part
GO:0043231	0.76	intracellular membrane-bounded organelle
GO:0031988	0.72	membrane-bounded vesicle
GO:0005634	0.69	nucleus
GO:0005730	0.63	nucleolus
GO:0005737	0.61	cytoplasm
GO:0005615	0.61	extracellular space
GO:0070062	0.55	extracellular exosome
GO:0044444	0.55	cytoplasmic part
GO:0032311	0.55	angiogenin-PRI complex
GO:0005605	0.55	basal lamina

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.165	1rraA	0.754	1.25	0.202	0.795	3.1.27.5	NA
2	0.162	2rnfA	0.714	1.69	0.183	0.769	4.2.1.81	NA
3	0.135	1k2aA	0.716	1.90	0.171	0.788	3.1.27.5	NA
4	0.135	2vq9A	0.674	1.94	0.162	0.750	3.1.27.-	NA
5	0.128	1h1hA	0.709	1.85	0.130	0.788	3.1.27.-	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.17	1srnA	0.693	1.08	0.186	0.724	1.20	III	complex1.pdb.gz	28,32,36,73,75,83,86,94,100,101,132,133,134,135,136,137,138,139,140,141
2	0.16	1qhcB	0.760	1.09	0.177	0.795	1.23	PUA	complex2.pdb.gz	28,31,35,36,72,73,93,95,99,137,147,148,149,150
3	0.14	1n3zA	0.737	0.95	0.185	0.763	1.31	ADN	complex3.pdb.gz	28,93,99,137,147,148
4	0.09	1rbjA	0.744	1.31	0.177	0.795	1.05	QNA	complex4.pdb.gz	31,35,36,69,71,72,73,93,95,97,99,111,137,139,147,148
5	0.05	1z6dB	0.762	1.06	0.177	0.795	1.04	IMP	complex5.pdb.gz	36,71,72,73,113,149,150,151
6	0.05	1dfj0	0.754	1.18	0.177	0.795	1.29	III	complex6.pdb.gz	31,35,50,57,58,66,67,69,70,71,94,95,99,114,116,117,119,137,139,148
7	0.03	11bgA	0.635	1.25	0.161	0.673	0.99	U2G	complex7.pdb.gz	50,54,122,123

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.