D-I-TASSER Q16572

D-I-TASSER results for Q16572

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q16572
Protein Name: Vesicular acetylcholine transporter
Gene Name: SLC18A3

Input Sequence in FASTA format

>Q16572 (532 residues)
MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGGEGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESE
DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFA
ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG
KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT
CNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYG
ALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS
ERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q16572-D1	1-275	275		MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDYIAHMRGGGEGPTRTPEVWEPTLPLPTPANASAYTANTSASPTAAWPAGSALRPRYPTESEDVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVLFAFAEDYATLFAARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAGKRVPFLVLAAVSLFDALLLLAVAKPFSAAARARAN
2	Q16572-D2	276-532	257		LPVGTPIHRLMLDPYIAVVAGALTTCNIPLAFLEPTIATWMKHTMAASEWEMGMAWLPAFVPHVLGVYLTVRLAARYPHLQWLYGALGLAVIGASSCIVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSVYAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRSERDVLLDEPPQGLYDAVRLRERPVSGQDGEPRSPPGPFDACEDDYNYYYTRS

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.84

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	7bc6A	0.69	3.32	0.136	0.769	model1_7bc6A.pdb.gz
2	6thaA	0.68	2.76	0.116	0.744	model1_6thaA.pdb.gz
3	6h7dA	0.68	3.19	0.117	0.769	model1_6h7dA.pdb.gz
4	4gbyA	0.68	2.99	0.146	0.756	model1_4gbyA.pdb.gz
5	7crzA	0.67	3.16	0.105	0.752	model1_7crzA.pdb.gz
6	4zowA	0.66	2.75	0.172	0.720	model1_4zowA.pdb.gz
7	6s4mA	0.66	3.44	0.174	0.741	model1_6s4mA.pdb.gz
8	6e9nA	0.65	2.90	0.172	0.722	model1_6e9nA.pdb.gz
9	6rw3A	0.65	3.04	0.159	0.731	model1_6rw3A.pdb.gz
10	6exsA	0.65	3.68	0.091	0.754	model1_6exsA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005215	0.99	transporter activity
GO:0022857	0.96	transmembrane transporter activity
GO:0022891	0.83	substrate-specific transmembrane transporter activity
GO:0022804	0.78	active transmembrane transporter activity
GO:0008504	0.77	monoamine transmembrane transporter activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0044699	0.97	single-organism process
GO:0006810	0.97	transport
GO:0009987	0.95	cellular process
GO:0044765	0.94	single-organism transport
GO:0044763	0.93	single-organism cellular process
GO:0007268	0.90	chemical synaptic transmission
GO:0006836	0.89	neurotransmitter transport
GO:0071702	0.57	organic substance transport
GO:0071705	0.55	nitrogen compound transport
GO:0051649	0.53	establishment of localization in cell
GO:0015842	0.50	aminergic neurotransmitter loading into synaptic vesicle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.99	cell part
GO:0044425	0.97	membrane part
GO:0016021	0.96	integral component of membrane
GO:0044459	0.93	plasma membrane part
GO:0005887	0.92	integral component of plasma membrane
GO:0044424	0.89	intracellular part
GO:0044444	0.85	cytoplasmic part
GO:0016020	0.83	membrane
GO:0097458	0.80	neuron part
GO:0044446	0.80	intracellular organelle part
GO:0044456	0.79	synapse part
GO:0031090	0.78	organelle membrane
GO:0098805	0.77	whole membrane
GO:0098588	0.77	bounding membrane of organelle
GO:0044433	0.77	cytoplasmic vesicle part
GO:0044463	0.76	cell projection part
GO:0030659	0.76	cytoplasmic vesicle membrane
GO:0030672	0.75	synaptic vesicle membrane
GO:0043195	0.74	terminal bouton

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2e1qA	0.315	8.33	0.061	0.558	1.17.3.2 1.17.1.4	NA
2	0.060	1kc7A	0.317	7.72	0.038	0.532	2.7.9.1	NA
3	0.060	3i39X	0.326	8.01	0.046	0.568	1.2.99.2	NA
4	0.060	3b9jC	0.284	8.25	0.040	0.502	1.17.3.2 1.17.1.4	NA
5	0.060	2ckjA	0.299	7.47	0.045	0.479	1.17.1.4 1.17.3.2	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	3cmvE	0.246	8.14	0.040	0.430	0.43	ANP	complex1.pdb.gz	125,128,129,130,131,183
2	0.01	2o01A	0.354	6.89	0.037	0.532	0.41	PQN	complex2.pdb.gz	137,138,142,158
3	0.01	2o01B	0.299	6.58	0.039	0.429	0.69	PQN	complex3.pdb.gz	127,128,190,433
4	0.01	1jqnA	0.343	7.37	0.041	0.543	0.59	ASP	complex4.pdb.gz	56,127,131,178,185
5	0.01	3rkoL	0.349	6.41	0.053	0.515	0.53	LFA	complex5.pdb.gz	126,129,130

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.