D-I-TASSER Q07507

D-I-TASSER results for Q07507

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q07507
Protein Name: Dermatopontin
Gene Name: DPT

Input Sequence in FASTA format

>Q07507 (201 residues)
MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVR
SIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYF
ESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVER
DRQWKFIMCRMTEYDCEFANV

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q07507-D1	1-201	201		MDLSLLWVLLPLVTMAWGQYGDYGYPYQQYHDYSDDGWVNLNRQGFSYQCPQGQVIVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAGMEWYQTCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWLTTEYPGHYGEEMDMISYNYDYYIRGATTTFSAVERDRQWKFIMCRMTEYDCEFANV

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.6319

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	6vlsA5	0.49	4.03	0.060	0.657	model1_6vlsA5.pdb.gz
2	6yrfA4	0.49	4.37	0.034	0.667	model1_6yrfA4.pdb.gz
3	6v1vA5	0.48	4.28	0.041	0.657	model1_6v1vA5.pdb.gz
4	7ntxA2	0.48	4.26	0.035	0.662	model1_7ntxA2.pdb.gz
5	6riwA	0.46	5.42	0.065	0.786	model1_6riwA.pdb.gz
6	1tqyA	0.46	5.55	0.048	0.791	model1_1tqyA.pdb.gz
7	3hmjA6	0.45	5.81	0.059	0.811	model1_3hmjA6.pdb.gz
8	4cw4A	0.45	5.57	0.075	0.781	model1_4cw4A.pdb.gz
9	6f5gA	0.45	5.42	0.043	0.771	model1_6f5gA.pdb.gz
10	2gqdA	0.44	5.70	0.055	0.781	model1_2gqdA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.35	catalytic activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0030199	1.00	collagen fibril organization
GO:0008285	1.00	negative regulation of cell proliferation

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044421	1.00	extracellular region part
GO:0031012	1.00	extracellular matrix
GO:0005737	1.00	cytoplasm
GO:0043227	0.74	membrane-bounded organelle
GO:0070062	0.69	extracellular exosome
GO:0005615	0.68	extracellular space

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1tqyA	0.460	5.55	0.048	0.791	2.3.1.41	NA
2	0.060	2pffA	0.440	5.65	0.056	0.776	2.3.1.41 2.3.1.86	NA
3	0.060	2x3eA	0.418	5.61	0.049	0.726	2.3.1.180	NA
4	0.060	2qx1A	0.427	5.40	0.062	0.721	2.3.1.180	46
5	0.060	2vz8B	0.426	5.93	0.071	0.766	2.3.1.85	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	1dluA	0.422	5.71	0.070	0.736	0.14	MPD	complex1.pdb.gz	113,114,115
2	0.01	2qx1A	0.432	5.57	0.087	0.741	0.17	D1T	complex2.pdb.gz	100,183,186
3	0.01	2qnzB	0.433	5.58	0.094	0.741	0.21	DFD	complex3.pdb.gz	171,173,183,184
4	0.01	2qnxA	0.432	5.60	0.087	0.741	0.20	MDX	complex4.pdb.gz	142,143,169,170,189
5	0.01	3h77A	0.432	5.68	0.062	0.741	0.14	COW	complex5.pdb.gz	111,168,170,171
6	0.01	1mzjA	0.429	5.47	0.055	0.731	0.11	UUU	complex6.pdb.gz	50,54,159,161,162,189,190
7	0.01	2buiB	0.444	5.43	0.062	0.741	0.14	OCA	complex7.pdb.gz	17,18,68
8	0.01	2qnxB	0.429	5.41	0.062	0.721	0.22	UDT	complex8.pdb.gz	114,131,133
9	0.01	2vz9B	0.427	5.82	0.064	0.756	0.10	NAP	complex9.pdb.gz	54,56,84,170
10	0.01	2vz9B	0.427	5.82	0.064	0.756	0.14	NAP	complex10.pdb.gz	85,169,170,171,185

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.