D-I-TASSER Q07021

D-I-TASSER results for Q07021

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: Q07021
Protein Name: Complement component 1 Q subcomponent-binding protein, mitochondrial
Gene Name: C1QBP

Input Sequence in FASTA format

>Q07021 (282 residues)
MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLR
PRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKL
VRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKK
ALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLM
DFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	Q07021-D1	1-282	282		MLPLLRCVPRVLGSSVAGLRAAAPASPFRQLLQPAPRLCTRPFGLLSVRAGSERRPGLLRPRGPCACGCGCGSLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.6776

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1p32A	0.62	1.57	0.995	0.645	model1_1p32A.pdb.gz
2	1yqfA	0.56	1.96	0.212	0.603	model1_1yqfA.pdb.gz
3	3jv1A	0.55	2.29	0.229	0.603	model1_3jv1A.pdb.gz
4	3qv0A	0.53	1.87	0.235	0.575	model1_3qv0A.pdb.gz
5	6lonB	0.42	6.41	0.052	0.723	model1_6lonB.pdb.gz
6	3lwtX	0.42	5.51	0.053	0.624	model1_3lwtX.pdb.gz
7	7kq3A	0.41	6.32	0.044	0.706	model1_7kq3A.pdb.gz
8	5m45A1	0.41	5.22	0.034	0.617	model1_5m45A1.pdb.gz
9	5fauA	0.41	6.27	0.048	0.706	model1_5fauA.pdb.gz
10	7k1wF	0.41	5.40	0.037	0.621	model1_7k1wF.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003676	0.93	nucleic acid binding
GO:0097367	0.92	carbohydrate derivative binding
GO:0044822	0.92	poly(A) RNA binding
GO:0097177	0.91	mitochondrial ribosome binding
GO:0031690	0.91	adrenergic receptor binding
GO:0030984	0.91	kininogen binding
GO:0005540	0.91	hyaluronic acid binding
GO:0003729	0.91	mRNA binding
GO:0003714	0.91	transcription corepressor activity
GO:0001849	0.91	complement component C1q binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	1.00	cellular process
GO:0065007	0.97	biological regulation
GO:0050794	0.96	regulation of cellular process
GO:1902531	0.95	regulation of intracellular signal transduction
GO:0034622	0.95	cellular macromolecular complex assembly
GO:0051246	0.90	regulation of protein metabolic process
GO:0048523	0.90	negative regulation of cellular process
GO:0048522	0.90	positive regulation of cellular process
GO:0031323	0.90	regulation of cellular metabolic process
GO:0009893	0.90	positive regulation of metabolic process
GO:0007165	0.90	signal transduction
GO:2000510	0.89	positive regulation of dendritic cell chemotaxis
GO:1901165	0.89	positive regulation of trophoblast cell migration
GO:1900026	0.89	positive regulation of substrate adhesion-dependent cell spreading
GO:0090023	0.89	positive regulation of neutrophil chemotaxis
GO:0070131	0.89	positive regulation of mitochondrial translation
GO:0051897	0.89	positive regulation of protein kinase B signaling
GO:0048025	0.89	negative regulation of mRNA splicing, via spliceosome
GO:0043065	0.89	positive regulation of apoptotic process
GO:0042256	0.89	mature ribosome assembly
GO:0039536	0.89	negative regulation of RIG-I signaling pathway
GO:0039534	0.89	negative regulation of MDA-5 signaling pathway
GO:0032695	0.89	negative regulation of interleukin-12 production
GO:0032689	0.89	negative regulation of interferon-gamma production
GO:0030449	0.89	regulation of complement activation
GO:0014065	0.89	phosphatidylinositol 3-kinase signaling
GO:0000122	0.89	negative regulation of transcription from RNA polymerase II promoter

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044424	1.00	intracellular part
GO:0043231	0.97	intracellular membrane-bounded organelle
GO:0005634	0.95	nucleus
GO:0005737	0.93	cytoplasm
GO:0044444	0.63	cytoplasmic part

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1rm6A	0.372	6.06	0.060	0.606	1.3.99.20	NA
2	0.060	1b3bE	0.378	5.83	0.054	0.599	1.4.1.3	127,130
3	0.060	2g5fA	0.374	5.92	0.027	0.610	5.4.4.2	NA
4	0.060	3k92A	0.373	6.10	0.059	0.617	1.4.1.2	125
5	0.060	1v9lA	0.374	6.05	0.075	0.610	1.4.1.2	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	1y791	0.390	6.11	0.018	0.656	0.12	UUU	complex1.pdb.gz	127,242,247
2	0.01	1mzoA	0.356	6.16	0.024	0.603	0.14	PYR	complex2.pdb.gz	123,170,246
3	0.01	1y791	0.390	6.11	0.018	0.656	0.13	UUU	complex3.pdb.gz	241,242,247,248

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.