D-I-TASSER P63124

D-I-TASSER results for P63124

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: P63124
Protein Name: Endogenous retrovirus group K member 104 Pro protein
Gene Name: HERV-K104

Input Sequence in FASTA format

>P63124 (156 residues)
WASQVSENRPVCKAIIQGKQFEGLVDTEADVSIIALNQWPKNWPKQKAVTGLVGIGTASE
VYQSTEILHCLGPDNQESTVQPMITSIPLNLWGQDLLQQWGAEITMPAPLYSPTSQKIMT
KMGYIPGKGLGKNEDGIKVPVEAKINQKREGIGYPF

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	P63124-D1	1-156	156		WASQVSENRPVCKAIIQGKQFEGLVDTEADVSIIALNQWPKNWPKQKAVTGLVGIGTASEVYQSTEILHCLGPDNQESTVQPMITSIPLNLWGQDLLQQWGAEITMPAPLYSPTSQKIMTKMGYIPGKGLGKNEDGIKVPVEAKINQKREGIGYPF

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.6091

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	1hvcA	0.66	3.08	0.187	0.821	model1_1hvcA.pdb.gz
2	3l58A	0.64	3.93	0.060	0.891	model1_3l58A.pdb.gz
3	4zl4A	0.64	4.16	0.065	0.910	model1_4zl4A.pdb.gz
4	4ehcA	0.64	3.70	0.116	0.859	model1_4ehcA.pdb.gz
5	1bxqA	0.63	4.24	0.080	0.891	model1_1bxqA.pdb.gz
6	1cziE	0.62	4.07	0.073	0.878	model1_1cziE.pdb.gz
7	1mppA	0.62	4.05	0.067	0.878	model1_1mppA.pdb.gz
8	1j71A	0.62	4.37	0.079	0.891	model1_1j71A.pdb.gz
9	1e82E	0.61	4.53	0.086	0.917	model1_1e82E.pdb.gz
10	1qdmA1	0.61	4.08	0.066	0.878	model1_1qdmA1.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0003824	0.93	catalytic activity
GO:0016740	0.92	transferase activity
GO:0004190	0.89	aspartic-type endopeptidase activity
GO:0003964	0.89	RNA-directed DNA polymerase activity
GO:0003676	0.75	nucleic acid binding
GO:0003723	0.62	RNA binding
GO:0004523	0.57	RNA-DNA hybrid ribonuclease activity
GO:0008270	0.56	zinc ion binding
GO:0004533	0.56	exoribonuclease H activity
GO:0003677	0.56	DNA binding

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0009987	0.99	cellular process
GO:0090304	0.93	nucleic acid metabolic process
GO:0044260	0.93	cellular macromolecule metabolic process
GO:0006278	0.89	RNA-dependent DNA biosynthetic process
GO:0044763	0.73	single-organism cellular process
GO:0016070	0.72	RNA metabolic process
GO:0016043	0.61	cellular component organization
GO:0071826	0.57	ribonucleoprotein complex subunit organization
GO:0090503	0.56	RNA phosphodiester bond hydrolysis, exonucleolytic
GO:0090502	0.56	RNA phosphodiester bond hydrolysis, endonucleolytic
GO:0075713	0.56	establishment of integrated proviral latency
GO:0050794	0.56	regulation of cellular process
GO:0046718	0.56	viral entry into host cell
GO:0015074	0.56	DNA integration
GO:0006310	0.56	DNA recombination
GO:0031323	0.53	regulation of cellular metabolic process
GO:0000390	0.53	spliceosomal complex disassembly
GO:0080090	0.52	regulation of primary metabolic process
GO:0060255	0.52	regulation of macromolecule metabolic process
GO:0010468	0.50	regulation of gene expression

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	1.00	cell part
GO:0044424	0.99	intracellular part
GO:0044446	0.86	intracellular organelle part
GO:0044428	0.82	nuclear part
GO:0032991	0.72	macromolecular complex
GO:0005681	0.68	spliceosomal complex
GO:0016020	0.53	membrane
GO:0071008	0.50	U2-type post-mRNA release spliceosomal complex

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.541	2rkgA	0.563	2.13	0.230	0.641	3.4.23.16	26,27
2	0.538	2p3dA	0.561	1.93	0.184	0.628	3.4.23.16	26,27
3	0.536	1hiiA	0.557	2.02	0.245	0.628	3.4.23.-	26,27
4	0.532	2p3cA	0.559	2.07	0.212	0.635	3.4.23.16	26,27
5	0.514	1fmbA	0.573	1.93	0.210	0.641	3.1.26.4	26,27

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.60	1bdrB	0.559	2.09	0.253	0.635	1.51	IM1	complex1.pdb.gz	26,28,29,30,52,53,54,55,89
2	0.57	2hs1A	0.562	2.05	0.253	0.635	1.41	017	complex2.pdb.gz	26,28,29,30,31,51,89
3	0.54	2rkfA	0.557	2.13	0.232	0.635	1.28	AB1	complex3.pdb.gz	26,28,29,30,31,33,55,88,91
4	0.53	3bheB	0.558	2.05	0.242	0.635	1.10	BZN	complex4.pdb.gz	26,28,29,52,53,91
5	0.52	1sdvA	0.557	2.11	0.242	0.635	1.23	MK1	complex5.pdb.gz	9,24,26,28,51,52,54,91
6	0.52	2aofA	0.556	2.14	0.253	0.635	1.32	III	complex6.pdb.gz	24,26,28,29,30,33,50,51,53,54,55,58,91
7	0.49	1mrxA	0.558	2.12	0.242	0.635	1.22	K57	complex7.pdb.gz	26,28,29,88,89
8	0.48	2hc0B	0.559	2.04	0.232	0.635	1.25	AB2	complex8.pdb.gz	9,26,28,29,30,31,50,51,52,87,88,91
9	0.48	2qi4B	0.559	2.10	0.242	0.635	1.36	MZ6	complex9.pdb.gz	24,26,29,31,33,52,53,54,88,89,91
10	0.47	3th9A	0.557	2.13	0.242	0.635	0.95	9Y9	complex10.pdb.gz	26,33,54,55,89,91

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.