D-I-TASSER P15018

D-I-TASSER results for P15018

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: P15018
Protein Name: Leukemia inhibitory factor
Gene Name: LIF

Input Sequence in FASTA format

>P15018 (202 residues)
MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSAN
ALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNIT
RDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQK
KKLGCQLLGKYKQIIAVLAQAF

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	P15018-D1	1-202	202		MKVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.7272

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	2q7nB	0.85	1.57	0.939	0.891	model1_2q7nB.pdb.gz
2	1a7mA	0.74	2.63	0.783	0.852	model1_1a7mA.pdb.gz
3	1rw5A	0.68	2.65	0.076	0.807	model1_1rw5A.pdb.gz
4	1evsA	0.64	2.56	0.200	0.743	model1_1evsA.pdb.gz
5	4mhlA	0.63	2.58	0.113	0.738	model1_4mhlA.pdb.gz
6	5tsaA	0.62	3.89	0.054	0.847	model1_5tsaA.pdb.gz
7	1cnt1	0.62	2.02	0.154	0.673	model1_1cnt1.pdb.gz
8	2il6A	0.61	2.70	0.109	0.728	model1_2il6A.pdb.gz
9	1i1rB	0.61	3.01	0.079	0.748	model1_1i1rB.pdb.gz
10	2l3yA	0.61	3.19	0.078	0.757	model1_2l3yA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005146	1.00	leukemia inhibitory factor receptor binding
GO:0008083	0.70	growth factor activity
GO:0005125	0.69	cytokine activity
GO:0001135	0.69	transcription factor activity, RNA polymerase II transcription factor recruiting

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:2000026	1.00	regulation of multicellular organismal development
GO:0051240	1.00	positive regulation of multicellular organismal process
GO:0051130	1.00	positive regulation of cellular component organization
GO:0048856	1.00	anatomical structure development
GO:0048519	1.00	negative regulation of biological process
GO:0046883	1.00	regulation of hormone secretion
GO:0044767	1.00	single-organism developmental process
GO:0023056	1.00	positive regulation of signaling
GO:0022603	1.00	regulation of anatomical structure morphogenesis
GO:0010720	1.00	positive regulation of cell development
GO:0010647	1.00	positive regulation of cell communication
GO:0080090	0.74	regulation of primary metabolic process
GO:0060255	0.74	regulation of macromolecule metabolic process
GO:0031323	0.74	regulation of cellular metabolic process
GO:0031325	0.73	positive regulation of cellular metabolic process
GO:0010604	0.73	positive regulation of macromolecule metabolic process
GO:0045893	0.72	positive regulation of transcription, DNA-templated
GO:0009987	0.72	cellular process
GO:0051246	0.71	regulation of protein metabolic process
GO:0048583	0.71	regulation of response to stimulus
GO:0019220	0.71	regulation of phosphate metabolic process
GO:0007165	0.71	signal transduction
GO:0048584	0.70	positive regulation of response to stimulus
GO:0048523	0.70	negative regulation of cellular process
GO:0045944	0.70	positive regulation of transcription from RNA polymerase II promoter
GO:0044707	0.70	single-multicellular organism process
GO:0009966	0.70	regulation of signal transduction
GO:0007166	0.70	cell surface receptor signaling pathway
GO:0002682	0.70	regulation of immune system process
GO:0001934	0.70	positive regulation of protein phosphorylation
GO:1901676	0.69	positive regulation of histone H3-K27 acetylation
GO:1900182	0.69	positive regulation of protein localization to nucleus
GO:0072307	0.69	regulation of metanephric nephron tubule epithelial cell differentiation
GO:0072108	0.69	positive regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis
GO:0048861	0.69	leukemia inhibitory factor signaling pathway
GO:0046888	0.69	negative regulation of hormone secretion
GO:0045651	0.69	positive regulation of macrophage differentiation
GO:0043410	0.69	positive regulation of MAPK cascade
GO:0042517	0.69	positive regulation of tyrosine phosphorylation of Stat3 protein
GO:0042511	0.69	positive regulation of tyrosine phosphorylation of Stat1 protein
GO:0033141	0.69	positive regulation of peptidyl-serine phosphorylation of STAT protein
GO:0008284	0.69	positive regulation of cell proliferation
GO:0044763	0.67	single-organism cellular process
GO:0051960	0.63	regulation of nervous system development
GO:0030154	0.63	cell differentiation
GO:0050769	0.62	positive regulation of neurogenesis
GO:0048513	0.62	animal organ development

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.87	cell part
GO:0044424	0.82	intracellular part
GO:0044421	0.71	extracellular region part
GO:0005615	0.70	extracellular space
GO:0005737	0.69	cytoplasm
GO:0005576	0.54	extracellular region

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	1ut9A	0.485	4.97	0.103	0.752	3.2.1.4	NA
2	0.060	1jqnA	0.441	5.21	0.053	0.708	4.1.1.31	NA
3	0.060	1clcA	0.476	5.16	0.045	0.762	3.2.1.4	NA
4	0.060	1biqB	0.536	3.87	0.040	0.723	1.17.4.1	NA
5	0.060	1smsA	0.529	4.19	0.050	0.738	1.17.4.1	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.03	1cnt0	0.619	2.02	0.154	0.673	1.05	III	complex1.pdb.gz	120,124,135,138,141,142,146,149,152,153,160,161
2	0.02	3d48P	0.564	3.03	0.092	0.703	0.96	CO3	complex2.pdb.gz	81,82,83,183,186
3	0.02	1a220	0.567	3.46	0.089	0.738	0.56	III	complex3.pdb.gz	60,63,64,90,185,186,189,190,192,193,196,197,200

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.