D-I-TASSER I1YAP6

D-I-TASSER results for I1YAP6

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: I1YAP6
Protein Name: Tripartite motif-containing protein 77
Gene Name: TRIM77

Input Sequence in FASTA format

>I1YAP6 (450 residues)
MASAITQCSTSELTCSICTDYLTDPVTICCGHRFCSPCLCLLWEDTLTPNCCPVCREISQ
QMYFKRIIFAEKQVIPTRESVPCQLSSSAMLICRRHQEIKNLICETDRSLLCFLCSQSPR
HATHKHYMTREADEYYRKKLLIQMKSIWKKKQKNQRNLNRETNIIGTWEVFINLRSMMIS
AEYPKVCQYLREEEQKHVESLAREGRIIFQQLKRSQTRMAKMGILLREMYEKLKEMSCKA
DVNLPQDLGDVMKRNEFLRLAMPQPVNPQLSAWTITGVSERLNFFRVYITLDRKICSNHK
LLFEDLRHLQCSLDDTDMSCNPTSTQYTSSWGAQILSSGKHYWEVDVKDSCNWVIGLCRE
AWTKRNDMRLDSEGIFLLLCLKVDDHFSLFSTSPLLPHYIPRPQGWLGVFLDYECGIVSF
VNVAQSSLICSFLSRIFYFPLRPFICHGSK

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	I1YAP6-D1	1-80	80		MASAITQCSTSELTCSICTDYLTDPVTICCGHRFCSPCLCLLWEDTLTPNCCPVCREISQQMYFKRIIFAEKQVIPTRES
2	I1YAP6-D2	81-181	101		VPCQLSSSAMLICRRHQEIKNLICETDRSLLCFLCSQSPRHATHKHYMTREADEYYRKKLLIQMKSIWKKKQKNQRNLNRETNIIGTWEVFINLRSMMISA
3	I1YAP6-D3	182-265	84		EYPKVCQYLREEEQKHVESLAREGRIIFQQLKRSQTRMAKMGILLREMYEKLKEMSCKADVNLPQDLGDVMKRNEFLRLAMPQP
4	I1YAP6-D4	266-450	185		VNPQLSAWTITGVSERLNFFRVYITLDRKICSNHKLLFEDLRHLQCSLDDTDMSCNPTSTQYTSSWGAQILSSGKHYWEVDVKDSCNWVIGLCREAWTKRNDMRLDSEGIFLLLCLKVDDHFSLFSTSPLLPHYIPRPQGWLGVFLDYECGIVSFVNVAQSSLICSFLSRIFYFPLRPFICHGSK

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.55

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	4wvmA	0.43	4.49	0.086	0.518	model1_4wvmA.pdb.gz
2	4wvmB	0.42	4.92	0.089	0.527	model1_4wvmB.pdb.gz
3	3ffzA	0.41	5.95	0.047	0.591	model1_3ffzA.pdb.gz
4	4cg4A	0.41	2.60	0.143	0.433	model1_4cg4A.pdb.gz
5	2wl1A	0.39	0.74	0.246	0.389	model1_2wl1A.pdb.gz
6	4b8eA	0.38	1.89	0.178	0.393	model1_4b8eA.pdb.gz
7	4n7iA	0.37	1.58	0.282	0.384	model1_4n7iA.pdb.gz
8	3kb5A	0.37	1.83	0.190	0.384	model1_3kb5A.pdb.gz
9	2iwgB	0.36	1.11	0.348	0.364	model1_2iwgB.pdb.gz
10	1a8dA1	0.26	4.98	0.049	0.340	model1_1a8dA1.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0004842	0.68	ubiquitin-protein transferase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.84	biological regulation
GO:0050789	0.84	regulation of biological process
GO:0050794	0.80	regulation of cellular process
GO:0009987	0.76	cellular process
GO:0048518	0.72	positive regulation of biological process
GO:0031323	0.69	regulation of cellular metabolic process
GO:0080090	0.68	regulation of primary metabolic process
GO:0060255	0.68	regulation of macromolecule metabolic process
GO:0048522	0.67	positive regulation of cellular process
GO:0010468	0.62	regulation of gene expression
GO:2001141	0.61	regulation of RNA biosynthetic process
GO:0048583	0.61	regulation of response to stimulus
GO:0071704	0.60	organic substance metabolic process
GO:0044238	0.60	primary metabolic process
GO:0006355	0.60	regulation of transcription, DNA-templated
GO:0044260	0.59	cellular macromolecule metabolic process
GO:0043900	0.59	regulation of multi-organism process
GO:0019538	0.58	protein metabolic process
GO:0065009	0.56	regulation of molecular function
GO:0006464	0.56	cellular protein modification process
GO:0023051	0.55	regulation of signaling
GO:0016567	0.55	protein ubiquitination
GO:0010646	0.55	regulation of cell communication
GO:0002376	0.55	immune system process
GO:0044093	0.54	positive regulation of molecular function
GO:0009966	0.54	regulation of signal transduction
GO:0051090	0.53	regulation of sequence-specific DNA binding transcription factor activity
GO:0051091	0.52	positive regulation of sequence-specific DNA binding transcription factor activity
GO:0048584	0.51	positive regulation of response to stimulus
GO:0051246	0.50	regulation of protein metabolic process

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.98	cell part
GO:0044424	0.97	intracellular part
GO:0043226	0.79	organelle
GO:0043229	0.75	intracellular organelle
GO:0044444	0.72	cytoplasmic part
GO:0032991	0.63	macromolecular complex
GO:0005737	0.60	cytoplasm
GO:0043232	0.57	intracellular non-membrane-bounded organelle
GO:0043227	0.55	membrane-bounded organelle

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	3gtgB	0.347	7.31	0.030	0.580	2.7.7.6	NA
2	0.060	1z0hB	0.228	7.40	0.033	0.384	3.4.24.69	NA
3	0.060	1rw9A	0.329	7.01	0.045	0.531	4.2.2.5	NA
4	0.060	1s76D	0.270	6.77	0.044	0.418	2.7.7.6	213
5	0.060	3ffzA	0.411	5.95	0.047	0.591	3.4.24.69	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Click to view	Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
	1	0.01	2e2iB	0.340	7.30	0.063	0.564	0.54	ZN	complex1.pdb.gz	30,53,55

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.