D-I-TASSER A0A1B0GTJ6

D-I-TASSER results for A0A1B0GTJ6

[Click result.zip to download all results on this page]

Summary of the Protein

Uniprot ID: A0A1B0GTJ6
Protein Name: HCG1796489
Gene Name: LOC101059948 hCG_1796489

Input Sequence in FASTA format

>A0A1B0GTJ6 (334 residues)
MASGTLAPGCRISATEVPGSRPNCHLTSSYFSHRIIPPIPFTPPTVQSTVADPLPQVAKQ
DSHNWAFDEVLSRWETTSGSAYVPKTHGGPCAQPRAPEPADPTRTVGIKDLGEKLRHRGW
RLPLTTKYQSSETRAQYTGSPSGDPRAPEYFGPQPPQLADHHRGGPSQALIAWTKNPELS
GRPFTVSDRGVLDRRQLYLTTSARDFRFYPKTELSGYPRKDSLTYWSFEETPQVWSHGPQ
RPPCPRSSRPPRPPRVRVPRVSPVTSAMPHRGALSLAQESYSPLLHPLRRLDRFCPLEAP
WGGPHWKPLRGIYSVPKAYSTENSSYGSLKPALV

Predicted Contact and Distance Map Used in D-I-TASSER simulation

Contact Map

Distance Map

D-I-TASSER simulation is guided by the consensus contact map (left figure) and distance map (right figure) derived based on confidence scores of AttentionPotential. In the contact, distance map and hydrogen bond networks, the axes mark the residue index along the sequence. For the contact map, each dot represents a residue pair with predicted contact, while for the distance map and hydrogen bond network, a color scale represents a distance of 1-20+ angstroms or a angle of 0-180 degree.

Information of Domain

No. of Domain	Domain	Domain Boundary	Length of Domain	Models of Domain	Sequence
1	A0A1B0GTJ6-D1	1-334	334		MASGTLAPGCRISATEVPGSRPNCHLTSSYFSHRIIPPIPFTPPTVQSTVADPLPQVAKQDSHNWAFDEVLSRWETTSGSAYVPKTHGGPCAQPRAPEPADPTRTVGIKDLGEKLRHRGWRLPLTTKYQSSETRAQYTGSPSGDPRAPEYFGPQPPQLADHHRGGPSQALIAWTKNPELSGRPFTVSDRGVLDRRQLYLTTSARDFRFYPKTELSGYPRKDSLTYWSFEETPQVWSHGPQRPPCPRSSRPPRPPRVRVPRVSPVTSAMPHRGALSLAQESYSPLLHPLRRLDRFCPLEAPWGGPHWKPLRGIYSVPKAYSTENSSYGSLKPALV

Top 1 final models from D-I-TASSER

Click to view	Rank^a	Download	Estimated TM-score^b
	1	model1.pdb.gz	0.4338

(a)

D-I-TASSER simulations generate a large ensemble of structural conformations, i.e. decoys. These decoys are clustered by SPICKER based on pairwise structure similarity to report up to five final models from the five largest clusters. Models are ranked in descending order of cluster size. If the simulations converge well, it is possible to have less than 5 models generated, which is usually an indication of good model quality.

(b)

The model confidence is quantitatified by estimated TM-score (eTM-score), calculated based on significance of threading template alignments, contact map satisfaction rate, mean absolute error between distance of model and distance of AttentionPotential, and convergence of D-I-TASSER simulations. eTM-score is typically in the range of [0, 1], with higher eTM-score signifies higher model confidence.

Proteins with similar structure

Top 10 structural analogs in PDB (as identified by TM-align)

Rank	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	Download Alignment
1	5dmyA	0.43	6.43	0.060	0.710	model1_5dmyA.pdb.gz
2	4ypjA	0.43	6.61	0.033	0.722	model1_4ypjA.pdb.gz
3	6hpdA	0.42	6.38	0.058	0.695	model1_6hpdA.pdb.gz
4	5mz61	0.42	6.60	0.056	0.704	model1_5mz61.pdb.gz
5	5t98A	0.42	6.53	0.049	0.704	model1_5t98A.pdb.gz
6	6b6lA	0.42	6.34	0.052	0.704	model1_6b6lA.pdb.gz
7	5t9aA	0.42	6.56	0.039	0.716	model1_5t9aA.pdb.gz
8	5euvA	0.41	6.65	0.040	0.713	model1_5euvA.pdb.gz
9	2xvgA	0.41	6.55	0.030	0.695	model1_2xvgA.pdb.gz
10	5jouA	0.41	6.53	0.047	0.686	model1_5jouA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analog is displayed using backbone trace.
(b)	Ranking of proteins is based on TM-score of the structural alignment between the query structure and known structures in the PDB library.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Gene Ontology (GO) Terms

./A0A1B0GTJ6-D1/GOsearchresult_final_MF.svg

Molecular Function (MF)

GO term	Cscore^GO	Name
GO:0005201	0.58	extracellular matrix structural constituent
GO:0016787	0.52	hydrolase activity

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Molecular Function. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

./A0A1B0GTJ6-D1/GOsearchresult_final_BP.svg

Biological Process (BP)

GO term	Cscore^GO	Name
GO:0065007	0.84	biological regulation
GO:0044763	0.84	single-organism cellular process
GO:0046331	0.51	lateral inhibition
GO:0044719	0.51	regulation of imaginal disc-derived wing size
GO:0040005	0.51	chitin-based cuticle attachment to epithelium
GO:0008362	0.51	chitin-based embryonic cuticle biosynthetic process
GO:0007475	0.51	apposition of dorsal and ventral imaginal disc-derived wing surfaces
GO:0007424	0.51	open tracheal system development

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Biological Process. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

./A0A1B0GTJ6-D1/GOsearchresult_final_CC.svg

Cellular Component (CC)

GO term	Cscore^GO	Name
GO:0044464	0.74	cell part
GO:0044424	0.63	intracellular part
GO:0044421	0.58	extracellular region part
GO:0043229	0.52	intracellular organelle
GO:0031012	0.51	extracellular matrix

Download full result of the above consensus prediction.

Click the graph to show a high resolution version.

(a)

Cscore^GO is the confidence score of predicted GO terms. Cscore^GO values range in between [0-1]; where a higher value indicates a better confidence in predicting the function using the template.

(b)

The graph shows the predicted terms within the Gene Ontology hierachy for Cellular Component. Confidently predicted terms are color coded by Cscore^GO:

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted Enzyme Commission (EC) Numbers

Top 5 enzyme homologs in PDB

Rank	Cscore^EC	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	EC Number	Predicted Active Site Residues
1	0.060	2fugU	0.371	6.68	0.065	0.647	1.6.99.5	NA
2	0.060	2e1qA	0.363	6.51	0.056	0.608	1.17.3.2 1.17.1.4	34
3	0.060	2vdcA	0.369	6.67	0.057	0.638	1.4.1.13	NA
4	0.060	2hoyA	0.296	7.42	0.022	0.557	5.4.3.8	NA
5	0.060	1no3A	0.380	6.74	0.033	0.662	1.13.11.12	NA

	Click on the radio buttons to visualize predicted active site residues.
(a)	Cscore^EC is the confidence score for the Enzyme Commission (EC) number prediction. Cscore^EC values range in between [0-1]; where a higher score indicates a more reliable EC number prediction.
(b)	TM-score is a measure of global structural similarity between query and template protein.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

Predicted Ligand Binding Sites

Template proteins with similar binding site:

Rank	Cscore^LB	PDB Hit	TM-score	RMSD^a	IDEN^a	Cov.	BS-score	Lig. Name	Download Complex	Predicted binding site residues
1	0.01	1siwA	0.383	7.13	0.045	0.698	0.38	SF4	complex1.pdb.gz	190,191,193,199,200
2	0.01	1q16A	0.386	6.98	0.045	0.689	0.22	SF4	complex2.pdb.gz	186,188,190,191,192
3	0.01	1zsqA	0.380	6.92	0.029	0.668	0.13	PIB	complex3.pdb.gz	268,271,272,273,274,275
4	0.01	2xvkA	0.410	6.54	0.026	0.692	0.17	FFX	complex4.pdb.gz	190,193,208
5	0.01	1zvrA	0.388	6.56	0.023	0.659	0.10	3PI	complex5.pdb.gz	70,73,74
6	0.01	1m7r0	0.381	6.90	0.028	0.668	0.17	III	complex6.pdb.gz	109,206,207,271
7	0.01	2fknA	0.392	6.73	0.065	0.662	0.11	NAD	complex7.pdb.gz	68,69,70

	Click on the radio buttons to visualize predicted binding site and residues.
(a)	Cscore^LB is the confidence score of predicted binding site. Cscore^LB values range in between [0-1]; where a higher score indicates a more reliable ligand-binding site prediction.
(b)	BS-score is a measure of local similarity (sequence & structure) between template binding site and predicted binding site in the query structure. Based on large scale benchmarking analysis, we have observed that a BS-score >1 reflects a significant local match between the predicted and template binding site.
(c)	TM-score is a measure of global structural similarity between query and template protein.
(d)	RMSD^a the RMSD between residues that are structurally aligned by TM-align.
(e)	IDEN^a is the percentage sequence identity in the structurally aligned region.
(f)	Cov. represents the coverage of global structural alignment and is equal to the number of structurally aligned residues divided by length of the query protein.

[Click result.zip to download all results on this page]

References:
1.	Wei Zheng, Chengxin Zhang, Yang Li, Robin Pearce, Eric W. Bell, Yang Zhang. Folding non-homology proteins by coupling deep-learning contact maps with I-TASSER assembly simulations. In preparation, 2020.