Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Free fatty acid receptor 2
Species	Homo sapiens (Human)
Gene	FFAR2
Synonym	FFA2R G protein-coupled receptor 43 G-protein coupled receptor 43 GPCR3 GPR43 FFA2 receptor [ Show all ]
Disease	Abortion Diabetes
Length	330
Amino acid sequence	MLPDWKSSLILMAYIIIFLTGLPANLLALRAFVGRIRQPQPAPVHILLLSLTLADLLLLLLLPFKIIEAASNFRWYLPKVVCALTSFGFYSSIYCSTWLLAGISIERYLGVAFPVQYKLSRRPLYGVIAALVAWVMSFGHCTIVIIVQYLNTTEQVRSGNEITCYENFTDNQLDVVLPVRLELCLVLFFIPMAVTIFCYWRFVWIMLSQPLVGAQRRRRAVGLAVVTLLNFLVCFGPYNVSHLVGYHQRKSPWWRSIAVVFSSLNASLDPLLFYFSSSVVRRAFGRGLQVLRNQGSSLLGRRGKDTAEGTNEDRGVGQGEGMPSSDFTTE
UniProt	O15552
Protein Data Bank	N/A
GPCR-HGmod model	O15552
3D structure model	This predicted structure model is from GPCR-EXP O15552.
BioLiP	N/A
Therapeutic Target Database	T28213
ChEMBL	CHEMBL5493
IUPHAR	226
DrugBank	N/A

Ligand

Name	ISOBUTYRIC ACID
Molecular formula	C4H8O2
IUPAC name	2-methylpropanoic acid
Molecular weight	88.106
Hydrogen bond acceptor	2
Hydrogen bond donor	1
XlogP	0.8
Synonyms	Propionic acid, 2-methyl- 11047-EP2311816A1 HSDB 5228 Tenox IBP-2 Grain Pr 11047-EP2316828A1 Iso-butyric acid Z955123672 2-methyl propanoic acid Isobutyric acid [UN2529] [Flammable liquid] 22228-82-6 (ammonium salt) Isobutyric acid, puriss. p.a., >=99.5% 88696-EP2305825A1 KS-00000X9W AC1Q1O87 Methylpropanoic acid, 2- alpha-Methylpropanoic acid NSC 62780 BRN 0635770 CTK3I9676 11047-EP2277848A1 DTXSID4021636 EPA Pesticide Chemical Code 101502 SC-23341 11047-EP2316457A1 I0103 TR-032122 11047-EP2374787A1 Isobutanoic acid 2-METHYL-PROPIONIC ACID Isobutyric acid, 99+% 79-31-2 Isopropylformate a-Methylpropanoate Kyselina isomaselna [Czech] ACMC-209ph0 MolPort-001-783-185 ALQ Propanoic acid, 2-methyl- Caswell No. 503AA Dimethylacetate 11047-EP2298763A1 11047-EP2308858A1 FT-0625068 Tenox IBP 2 11047-EP2316826A1 ISB UNII-8LL210O1U0 1iup 2-Methylpropionsaeure Isobutyric acid, certified reference material, TraceCERT(R) 88696-EP2295411A1 KB-77935 a-Methylpropionic acid MCULE-7783770647 alpha-isobutyric acid NCGC00248957-01 BBL011415 11047-EP2272841A1 DSSTox_GSID_21636 RP18490 11047-EP2311817A1 i-butyrate Tenox IBP-2 Grain Pr. 11047-EP2371803A1 iso-C3H7COOH ZINC901420 2-Methyl Propionic Acic, Natural Isobutyric acid [UN2529] [Flammable liquid] 4-02-00-00843 (Beilstein Handbook Reference) Isobutyricacid 8LL210O1U0 KSC489M7N AC1Q5RPW methylpropionic acid alpha-Methylpropionate NSC-62780 C02632 .alpha.-Methylpropanoic acid D06ZVB 11047-EP2289510A1 EC 201-195-7 F2191-0099 STL146521 11047-EP2316458A1 I14-10607 UN 2529 11047-EP2377843A1 Isobuttersaeure 2-Methylpropanoic acid Isobutyric acid, >=99%, FCC, FG 88696-EP2287158A1 Isopropylformic acid a-Methylpropanoic acid LMFA01020071 AI3-24260 Nat.Isobutyric Acid AN-23989 Cenex RP b2 11047-EP2269610A2 Dimethylacetic acid 11047-EP2298772A1 Propanoic acid,2-methyl- 11047-EP2311453A1 GTPL1060 Tenox IBP-2 11047-EP2316827A1 iso-Butyrate WLN: QVY1&1 2,2-dimethylacetic acid Isobutyric acid (natural) 2-Propanecarboxylic acid Isobutyric acid, natural, >=99%, FCC, FG 88696-EP2298777A2 KQNPFQTWMSNSAP-UHFFFAOYSA-N AC1L1MVA methylpropanoic acid alpha-Methylpropanoate NCGC00258759-01 bmse000439 CHEMBL108778 11047-EP2275401A1 DSSTox_RID_76250 EINECS 201-195-7 RTR-032122 11047-EP2311822A1 i-Butyric acid Tox21_201207 11047-EP2374538A1 Isobutanoate 2-methyl-propanoic acid Isobutyric acid, 99% 533-90-4 (calcium salt) isopropyl carboxylic acid 996-30-5 (hydrochloride salt) Kyselina isomaselna Acetic acid, dimethyl- MFCD00002658 alpha-Methylpropionic acid NSC62780 CAS-79-31-2 .alpha.-Methylpropionic acid DB02531 11047-EP2295055A2 FEMA No. 2222 Tenox EBP 2 11047-EP2316825A1 InChI=1/C4H8O2/c1-3(2)4(5)6/h3H,1-2H3,(H,5,6 UN2529 19455-20-0 (potassium salt) Isobutyrate 2-Methylpropionic acid Isobutyric acid, analytical standard 88696-EP2289876A1 K400 a-Methylpropionate LS-2857 AKOS000118733 NATURAL ISOBUTYRIC ACID ANW-37282 CHEBI:16135 11047-EP2270003A1 DSSTox_CID_1636 11047-EP2308839A1 [ Show all ]
Inchi Key	KQNPFQTWMSNSAP-UHFFFAOYSA-N
Inchi ID	InChI=1S/C4H8O2/c1-3(2)4(5)6/h3H,1-2H3,(H,5,6)
PubChem CID	6590
ChEMBL	CHEMBL108778
IUPHAR	1060
BindingDB	N/A
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
EC50	158489.0 - 630957.0 nM	PMID12711604	IUPHAR

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417