Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	dicyclomine
Molecular formula	C19H35NO2
IUPAC name	2-(diethylamino)ethyl 1-cyclohexylcyclohexane-1-carboxylate
Molecular weight	309.494
Hydrogen bond acceptor	3
Hydrogen bond donor	0
XlogP	5.5
Synonyms	IDI1_000162 AC1Q2ZDW KBioGR_001057 Bentyl hydrochloride LS-56640 BRD-K68507560-003-05-5 NCGC00015368-04 CAS-67-92-5 NCGC00024386-04 Cyclohexanecarboxylic acid, 1-cyclohexyl-, 2-(diethylamino)ethyl ester Prestwick3_000048 Dicicloverina Spectrum2_000590 Dicycloverine (Dicyclomine) (Bicyclohexyl)-1-carboxylic acid, 2-(diethylamino)ethyl ester Dilomine (TN) 2-(diethylamino)ethyl 1,1'-bi(cyclohexyl)-1-carboxylate Dyspas Tox21_113571_1 [Bicyclohexyl]-1-carboxylic acid, 2-(diethylamino)ethyl ester 856995-49-8 KBio1_000162 Atumin L000680 Bentylol hydrochloride Merbentyl BSPBio_002175 NCGC00015368-07 CHEBI:4514 NSC404381 SBI-0050417.P004 Dicyclomine Hcl Dicycloverinum DivK1c_000162 2-diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate Formulex (TN) Spectrum5_000873 Wyovin HMS3604H12 AB00053456_15 KBio2_006550 Bentyl Lopac0_000432 Bicyclohexyl-1-carboxylic acid 2-diethylamino-ethyl ester NCGC00015368-02 C06951 NCGC00016300-01 CURUTKGFNZGFSE-UHFFFAOYSA- Prestwick1_000048 Di-syntramine SPBio_000440 Dicycloverin hydrochloride Dicymine (TN) 1-Cyclohexylcyclohexanecarboxylic acid 2-(diethylamino)ethyl ester DSSTox_RID_76790 STL356799 [1, 2-(diethylamino)ethyl ester, hydrochloride InChI=1/C19H35NO2/c1-3-20(4-2)15-16-22-18(21)19(13-9-6-10-14-19)17-11-7-5-8-12-17/h17H,3-16H2,1-2H3 AC1Q2ZDX KBioSS_001414 Bentylol Mamiesan BRD-K68507560-003-15-4 NCGC00015368-05 CAS-77-19-0 NINDS_000162 D07820 Procyclomin Dicicloverina [INN-Spanish] Spectrum3_000388 Dicycloverine (INN) (BICYCLOHEXYL)-1-CARBOXYLIC ACID, 2-(DIETHYLAMINO)ETHYL ESTER, HYDROCHLORIDE Diocyl 2-(diethylamino)ethyl 1-cyclohexylcyclohexane-1-carboxylate EINECS 201-009-4 67-92-5 (hydrochloride) UNII-4KV4X8IF6V [Bicyclohexyl]-1-carboxylic acid, 2-(diethylamino)ethyl ester hydrochloride AB00053456 KBio2_001414 BDBM50010101 Lomine (TN) beta-Diethylaminoethyl 1-cyclohexylcyclohexanecarboxylate hydrochloride Merbentyl (TN) Byclomine NCGC00015368-08 Oxityl-P DB00804 SCHEMBL3317 Dicyclomine [INN] Dicycloverinum [INN-Latin] .beta.-Diethylaminoethyl 1-cyclohexylcyclohexanecarboxylate hydrochloride DSSTox_CID_2926 2-diethylaminoethyl 1-cyclohexylcyclohexane-1-carboxylate hydrochloride GTPL355 Spectrum_000934 Wyovin hydrochloride HSDB 3058 AC1L1F1K KBio3_001395 Bentyl (TN) LS-177325 BPBio1_000193 NCGC00015368-03 C19H35NO2 NCGC00024386-03 CURUTKGFNZGFSE-UHFFFAOYSA-N Prestwick2_000048 Dibent (TN) SPBio_002096 Dicycloverine (1,1'-Bicyclohexyl)-1-carboxylic acid, 2-(diethylamino)ethyl ester Diethylaminocarbethoxybicyclohexyl hydrochloride 104959-55-9 DTXSID1022926 4KV4X8IF6V Tox21_113571 [1,1'-Bicyclohexyl]-1-carboxylic acid, 2-(diethylamino)ethyl ester J.L. 998 AKOS022107181 Kolantyl hydrochloride Bentylol (TN) MCULE-9110194493 BSPBio_000175 NCGC00015368-06 CCG-204524 NSC-404381 D07XJM Sawamin Dicycloverine [INN:BAN] (Bicyclohexyl)-1-carboxylic acid, hydrochloride Diocyl hydrochloride 2-(diethylamino)ethyl 1-cyclohexylcyclohexanecarboxylate Formulex 77-19-0 Spectrum4_000509 WLN: L6TJ A- AL6TJ AVO2N2&2 &GH AB00053456_14 KBio2_003982 Bentomine Lopac-D-7909 Bicyclohexyl-1-carbonsaeure-2'diethylaminoethylester NCGC00015368-01 Byclomine (TN) NCGC00015368-11 CHEMBL1123 Prestwick0_000048 Di-Spaz (TN) Spasmoban Dicycloverin Dicymine .beta.-Diethylaminoethyl-1-cyclohexylhexahydrobenzoate hydrochloride DSSTox_GSID_22926 2-diethylaminoethyl 1-cyclohexylcyclohexanecarboxylate GU8471000 ST45026134 ZINC1530613 [ Show all ]
Inchi Key	CURUTKGFNZGFSE-UHFFFAOYSA-N
Inchi ID	InChI=1S/C19H35NO2/c1-3-20(4-2)15-16-22-18(21)19(13-9-6-10-14-19)17-11-7-5-8-12-17/h17H,3-16H2,1-2H3
PubChem CID	3042
ChEMBL	CHEMBL1123
IUPHAR	355
BindingDB	50010101
DrugBank	DB00804
Structure SDF download
Lipinski's druglikeness	This ligand has a partition coefficient log P greater than 5.

Experimental Data

Parameter	Value	Reference	Database source
IC50	468.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL
Ki	245.0 nM	DrugMatrix in vitro pharmacology data	ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417