Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	2-Phenylcyclopropanamine
Molecular formula	C9H11N
IUPAC name	2-phenylcyclopropan-1-amine
Molecular weight	133.194
Hydrogen bond acceptor	1
Hydrogen bond donor	1
XlogP	1.5
Synonyms	CCRIS 3344 Tranylcyprominum [INN-Latin] Cyclopropanamine, trans-(.+-.)- EN300-54719 Jatrosom l-Tranylcypromine NCGC00162316-01 (+/-)-trans-2-phenylcyclopropylamine Parnitene (1S)-2-phenylcyclopropan-1-amine SKF Trans-385 Tranilcipromina AELCINSCMGFISI-UHFFFAOYSA-N Transapin (TN) Tranylcypromine (INN) CHEMBL313833 US8609708, 6 Tranylcypromine Cyclopropylamine, trans-2-phenyl- GJZ KBio2_004646 LS-58824 NSC80664 (.+/-.)-trans-2-Phenylcyclopropamine SBB084038 Spectrum3_001068 54-97-7 trans-(-)-2-Phenylcyclopropanamine BDBM50113851 Tranylcypromine,(-) Cyclopropanamine, 2-phenyl-, (1R-trans)-(9CI) dl-Tranylcypromine GTPL5281 KBioGR_001658 NCGC00015848-03 (+)-trans-2-Phenylcyclopropylamine Parnate (Salt/Mix) (1R,2S)-2-phenylcyclopropan-1-amine Sicoton (TN) 2-Phenyl-cyclopropylamine Spectrum_001598 AC1Q1HO9 Transamine C9H11N CHEBI:131512 Tylciprine (TN) Cyclopropylamine, 2-phenyl-, trans-(+-)- esparma Brand of Tranylcypromine Sulfate Jatrosom (TN) Link Brand of Tranylcypromine Sulfate NSC 80664 (+/-)-Tranylcypromine Parstelin (TN) (1S,2S)-2-phenylcyclopropan-1-amine SKF-trans-385 2-phenylcyclopropylamine Tranilcipromina [INN-Spanish] AKOS005217104 Tranylcypromin Tranylcypromine [INN:BAN] CTK1F7780 D0H0HJ GlaxoSmithKline Brand of Tranylcypromine Sulfate KBio2_007214 MCULE-7015811838 Parmodalin (TN) (.+/-.)-trans-2-Phenylcyclopropylamine SC-66350 2- Amino-cyclopropylbenzene Spectrum4_001219 AB01007711-01 trans-2-Phenylcyclopropylamine BRN 3195803 CCG-40399 Tranylcyprominum Cyclopropanamine, 2-phenyl-, trans-(+-)- EINECS 205-841-9 HSDB 3404 KBioSS_002078 NCGC00015848-04 (+)-Tranylcypromine Parnate (TN) (1R,2R)-2-phenylcyclopropan-1-amine SKF 385 2-phenylcyclopropan-1-amine Sulfate, Tranylcypromine AC1Q53BI Transamine (TN) US8609708, 6 Tranyl- cypromine Cyclopropylamine, trans-(.+-.)- F2173-0870 KBio2_002078 Lopac0_001013 NSC-80664 (-)-Tranylcypromine Racemic Tranylcypromine (2S)-2-phenylcyclopropan-1-amine SmithKline Brand of Tranylcypromine Sulfate trans 2 Phenylcyclopropylamine Allphar Brand of Tranylcypromine Sulfate tranylcypromine Tranylcypromine,(+) Cyclopropanamine, 2-phenyl- DB00752 Goldshield Brand of Tranylcypromine Sulfate KBio3_001876 NCGC00015848-02 Parnate (.+/-.)-Tranylcypromine SCHEMBL40651 2-PCPA Spectrum5_001829 AC1L1KJT trans-DL-2-Phenylcyclopropylamine BS-13286 [ Show all ]
Inchi Key	AELCINSCMGFISI-UHFFFAOYSA-N
Inchi ID	InChI=1S/C9H11N/c10-9-6-8(9)7-4-2-1-3-5-7/h1-5,8-9H,6,10H2
PubChem CID	5530
ChEMBL	CHEMBL313833
IUPHAR	N/A
BindingDB	50113851
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
EC50	2697.0 nM	PMID19284718	BindingDB,ChEMBL
Emax	109.0 %	PMID19284718	ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417