Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●D-I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●D-QUARK ●DRfold ●DRfold2 ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●ATGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred ●TCRfinder

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●TM-search ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●DeepMSA2 ●rMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●HPmod ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	Trace amine-associated receptor 1
Species	Mus musculus (Mouse)
Gene	Taar1
Synonym	TA1 receptor TaR-1 TAR1 trace amine receptor 1 TRAR1
Disease	N/A for non-human GPCRs
Length	332
Amino acid sequence	MHLCHAITNISHRNSDWSREVQASLYSLMSLIILATLVGNLIVIISISHFKQLHTPTNWLLHSMAIVDFLLGCLIMPCSMVRTVERCWYFGEILCKVHTSTDIMLSSASIFHLAFISIDRYCAVCDPLRYKAKINISTILVMILVSWSLPAVYAFGMIFLELNLKGVEELYRSQVSDLGGCSPFFSKVSGVLAFMTSFYIPGSVMLFVYYRIYFIAKGQARSINRTNVQVGLEGKSQAPQSKETKAAKTLGIMVGVFLVCWCPFFLCTVLDPFLGYVIPPSLNDALYWFGYLNSALNPMVYAFFYPWFRRALKMVLLGKIFQKDSSRSKLFL
UniProt	Q923Y8
Protein Data Bank	N/A
GPCR-HGmod model	N/A
3D structure model	No available structures or models
BioLiP	N/A
Therapeutic Target Database	N/A
ChEMBL	CHEMBL4908
IUPHAR	364
DrugBank	N/A

Ligand

Name	D-Amphetamine
Molecular formula	C9H13N
IUPAC name	(2S)-1-phenylpropan-2-amine
Molecular weight	135.21
Hydrogen bond acceptor	1
Hydrogen bond donor	1
XlogP	1.8
Synonyms	d-1-Phenyl-2-aminopropan [German] D0U5GS Dexadrine (+)-Amphetamine Dexamphetamine (S)-(+)-Amphetamine dextro Amphetamine (S)-alpha-Methylphenethylamine dl-1-Phenyl-2-aminopropane KWTSXDURSIMDCE-QMMMGPOBSA-N 66937-EP2298779A1 Phenethylamine, alpha-methyl-, (+)- Amsustain S(+)-Amphetamine (dextro-Amphetamine) solution, 1.0 mg/mL in methanol, ampule of 1 mL, certified reference material BRN 2205872 UNII-CK833KGX7E component KWTSXDURSIMDCE-QMMMGPOBSA-N ZINC6021033 D-alpha-methylphenethylamine DEA No. 1100 Dexamfetamine (+/-)-beta-Phenylisopropylamine Dexanfetamina (S)-1-Phenyl-2-aminopropane Dextroamphetamine (USAN) 1WE EINECS 200-112-1 66937-EP2272825A2 LS-187774 AB01563181_01 Phenethylamine, alpha-methyl-, d- Benzeneethanamine, alpha-methyl-, (alphaS)- Simpatedrin D03740 Desamfetamina [DCIT] (+)-alpha-Methylphenethylamine Dexamfetaminum (2S)-1-phenylpropan-2-amine Dexedrine Spansule (S)-1-phenylpropan-2-amine Dextroamphetamine [USAN] 3798-EP2280010A2 HSDB 3055 66937-EP2298772A1 PDSP2_001495 alpha-Methylphenethylamine, d-form Rhinalator Benzeneethanamine, alpha-methyl-, (S)- Sympatedrine D-(S)-Amphetamine D-1-Phenyl-2-aminopropane Dexamfetamina (+)-Phenaminum Dexamphetaminum (S)-(+)-Amphetamine (Dextroamphetamine) 1.0 mg/ml in Methanol dextro-Amphetamine (S)-alpha-Phenylethylamine dl-Benzedrine 51-64-9 Liquadd 66937-EP2305648A1 Phenethylamine, alpha-methyl-, (+)- (8CI) BDBM50022723 S(+)amphetamine C07884 UNII-TZ47U051FI [1-(3-Methoxyphenyl)-2-propyl]amine D-AM Dephadren Dexamfetamine (INN) (+/-)-Desoxynorephedrine Dexanfetamina [INN-Spanish] (S)-1-Phenyl-2-propanamine Dextroamphetamine resin complex Epitope ID:224549 66937-EP2295406A1 NSC 73713 AB03711 Propisamine Benzeneethanamine, alpha-methyl-, (aS)- (9CI) Sympamin CHEMBL612 D-1-Phenyl-2-aminopropan D0T3LF Dexacaps (+)-alpha-Methylphenylethylamine Dexamfetaminum [INN-Latin] (alphaS)-alpha-methylbenzeneethanamine Dexidrine (S)-alpha-methylbenzeneethanamine Dextrostat 4-12-00-02587 (Beilstein Handbook Reference) Isoamycin 66937-EP2298776A1 Phenamine Amphetamine [DEA] S(+)-Amphetamine beta-phenyl-isopropylamine TZ47U051FI D-2-Amino-1-phenylpropane DB01576 Dexamfetamina [INN-Spanish] (+/-)-Benzedrine Dexamphetaminum [INN-Latin] (S)-(+)-beta-Phenylisopropylamine dextroamphetamine (S)-Amphetamine DTXSID8022907 66937-EP2269989A1 LS-103617 66937-EP2308839A1 Phenethylamine, alpha-methyl-, (+)-(8CI) Benzedrine SCHEMBL8859 CHEBI:4469 Weckamine Desamfetamina (+)-(S)-Amphetamine Dexamfetamine [INN] (2S)-(+)-Amphetamine Dexedrine (S)-1-Phenyl-2-propylamine dextroamphetamine sulfate (oral liquid, ADHD), Auriga 3798-EP2275420A1 GTPL2147 66937-EP2298742A1 PDSP1_001511 AC1L1L85 Raphetamine Benzeneethanamine, alpha-methyl-, (aS)-(9CI) Sympamine D-(+)-Amphetamine [ Show all ]
Inchi Key	KWTSXDURSIMDCE-QMMMGPOBSA-N
Inchi ID	InChI=1S/C9H13N/c1-8(10)7-9-5-3-2-4-6-9/h2-6,8H,7,10H2,1H3/t8-/m0/s1
PubChem CID	5826
ChEMBL	CHEMBL612
IUPHAR	2147
BindingDB	50022723
DrugBank	DB01576
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
EC50	1.99526 - 199.526 nM	PMID17218486, PMID17212650	IUPHAR
EC50	2.0 nM	PMID22037049	BindingDB,ChEMBL
EC50	84.6 nM	PMID24354319	ChEMBL
EC50	210.0 nM	PMID22037049	BindingDB,ChEMBL
Emax	99.8 %	PMID24354319	ChEMBL

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417