Zhang Lab

National University of Singapore

Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

GLASS

You can:

Go to the GPCR, ligand, or experimental data tables.
Go to the experimental data table for text mining information in PubMed ID column.
Go to the GPCR page and check other ligands which interact with it.
Go to the ligand page and check other GPCRs which it interacts with.
Go back to previous page.

GPCR

Name	5-hydroxytryptamine receptor 2C
Species	Homo sapiens (Human)
Gene	HTR2C
Synonym	Serotonin receptor 2C serotonin 1c receptor 5-HT1C 5-HT2C 5-HT-2C 5-HT2C receptor 5-HTR2C 5-hydroxytryptamine (serotonin) receptor 2C, G protein-coupled 5-hydroxytryptamine receptor 1C HTR1C 5-HT-1C [ Show all ]
Disease	Pain Sleep initiation and maintenance disorders; Primary insomnia; Schizophrenia Unspecified Depression Drug abuse Generalized anxiety disorder; Major depressive disorder Major depressive disorder Metabolic disorders Psychotic disorders Mood disorder Neurological disease Obesity Obesity; Diabetes Migraine headaches Anxiety disorder Alcohol use disorders Aggressive non-hodgkin's lymphoma [ Show all ]
Length	458
Amino acid sequence	MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTNEPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
UniProt	P28335
Protein Data Bank	6bqg, 6bqh
GPCR-HGmod model	P28335
3D structure model	This structure is from PDB ID 6bqg.
BioLiP	BL0404805, BL0404806
Therapeutic Target Database	T83813
ChEMBL	CHEMBL225
IUPHAR	8
DrugBank	BE0004957, BE0004881, BE0000533

Ligand

Name	tryptamine
Molecular formula	C10H12N2
IUPAC name	2-(1H-indol-3-yl)ethanamine
Molecular weight	160.22
Hydrogen bond acceptor	1
Hydrogen bond donor	2
XlogP	1.6
Synonyms	NCGC00095081-04 AN-41829 SC-05762 bmse000207 Spectrum3_001890 CCRIS 8959 STK262895 DB08653 (Amino-2 ethyl)-3 indole FT-0081340 2-(1H-indol-3-yl)-ethyl-amine IDI1_000862 2-(Indol-3-yl)ethylamine KBio2_005529 3-Indoleethylamine LS-82268 5E7B376B-5933-446C-9D88-661B5F480122 Tryptamin NCGC00014994-03 ACN-036699 V2315 AE-848/30735051 [2-(1h-indol-3-yl)ethyl]amine Oprea1_870097 AZ0001-0257 SDCCGMLS-0066798.P001 BRD-K44218819-001-05-1 Spectrum_000033 CHEMBL6640 EBD10651 .beta.-(3-Indolyl)ethylamine HMS1922K18 2-(1H-Indol-3-yl)ethanamine Indole, 3-(2-aminoethyl)- 2-Indol-3-ylethylamine KBioSS_000393 343-94-2 (mono-hydrochloride) T-8100 MFCD00005661 AB1001199 Tryptamine, analytical standard NCGC00014994-06 ALBB-017957 RTC-066345 BDBM50024210 SPECTRUM1503922 C00398 ST2409261 D08CJK F2169-0960 1H-Indole-3-ethanamine HTS028111 2-(3-Indolyl)ethylamine KBio2_000393 3-(beta-aminoethyl)-indole Lopac-246557 5-22-10-00045 (Beilstein Handbook Reference) TRA0076983 NCGC00014994-01 ACMC-209mtp tryptaminium NCGC00095081-02 NCGC00095081-05 ANW-33851 SCHEMBL13006684 BP-12561 Spectrum4_000850 CHEBI:16765 T-8095 DivK1c_000862 (Amino-2 ethyl)-3 indole [French] FT-0613523 2-(1H-INDOL-3-YL)-ETHYLAMINE InChI=1/C10H12N2/c11-6-5-8-7-12-10-4-2-1-3-9(8)10/h1-4,7,12H,5-6,11H 2-Indol-3-yl-aethylamin KBio3_002903 3-indolylethylamine M-3012 61-54-1 NCGC00014994-04 ACN-F000556 VI30132 AJ-11665 PubChem9450 BBL015353 SMR000112268 BRN 0125513 SR-01000075589 CS-D1750 EC 200-510-5 005T661 HMS2267B18 2-(1H-Indol-3-yl)ethanamine # KB-81364 3-(2-amino)ethyl indole KSC354A2B 34685-69-3 (unspecified sulfate) T0890 MLS000515794 AC1L1AU8 Tryptamine, free base NCGC00014994-07 NCGC00095081-03 AM807158 SBB003963 beta-(3-Indolyl)ethylamine Spectrum2_000873 CCG-40088 ST50308344 DB-005731 (3-Indolyl)ethylamine FS-3317 2-(1h-indol-3-yl) ethylamine HY-B2132 2-(3-Indolyl)ethylamine; 3-(2-Aminoethyl)indole KBio2_002961 3-Indoleethanamine Lopac0_000061 triptamine NCGC00014994-02 ACN-000556 UNII-422ZU9N5TV NINDS_000862 APJYDQYYACXCRM-UHFFFAOYSA-N SCHEMBL26725 BR-80344 Spectrum5_001296 DTXSID2075340 GTPL125 2-(1H-Indol-3-Yl)Ethan-1-Amine Indol-3-ethylamine 2-indol-3-yl-ethylamine KBioGR_001459 3-[2-Aminoethyl]indole MCULE-6402431765 AB0007015 Tryptamine, 98% NCGC00014994-05 ACT09907 ZINC120144 AKOS000119468 RP22361 BCP21605 SPBio_000945 BSPBio_003400 SR-01000075589-5 CTK2F4020 EINECS 200-510-5 HMS502L04 2-(1H-indol-3-yl)ethylamine KBio1_000862 3-(2-aminoethyl)indole L000946 422ZU9N5TV TC-066345 MolPort-001-002-280 AC1Q54C3 Tryptamine, Vetec(TM) reagent grade, 98% NCGC00095081-01 [ Show all ]
Inchi Key	APJYDQYYACXCRM-UHFFFAOYSA-N
Inchi ID	InChI=1S/C10H12N2/c11-6-5-8-7-12-10-4-2-1-3-9(8)10/h1-4,7,12H,5-6,11H2
PubChem CID	1150
ChEMBL	CHEMBL6640
IUPHAR	125
BindingDB	50024210
DrugBank	N/A
Structure SDF download
Lipinski's druglikeness	This ligand satisfies Lipinski's rule of five.

Experimental Data

Parameter	Value	Reference	Database source
Ki	45.7088 nM	PMID10498829	PDSP
Ki	45.71 nM	PMID10498829	BindingDB
Ki	50.0 nM	PMID3543362	BindingDB,ChEMBL
Ki	63.0957 - 2511.89 nM	PMID15322733, PMID10611640	IUPHAR
Ki	295.12 nM	PMID9225287	PDSP,BindingDB
Ki	2344.23 nM	PMID15322733	PDSP
Ki	2344.23 nM	PMID15322733	BindingDB
Ki	3000.0 nM	PMID8510008	BindingDB

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417