DEMO Results for job DOT790195786

[Click on DOT790195786_results.tar.bz2 to download the tarball file including all results listed on this page]

Query Sequence and Domain Definition

>example (262 residues)
GIDPNRIVALEWLPVELLLALGIVPYGVADTINYRLWVSEPPLPDSVIDVGLRTEPNLELLTEMKPSFMVWSAGYGPSPEMLARIAPGRGFNFSDGKQPLAMARKSLTEMADLLNLQSAAETHLAQYEDFIRSMKPRFVKRGARPLLLTTLIDPRHMLVFGPNSLFQEILDEYGIPNAWQGETNFWGSTAVSIDRLAAYKDVDVLCFDHDNSKDMDALMATPLWQAMPFVRAGRFQRVPAVWFYGATLSAMHFVRVLDNAIG
domain 1: 1-94 domain 2: 95-262
2 domains in total. Different colors represent different domains.

Input Individual Domain Structures

Structure of domain 1 (download dom1.pdb)

Structure of domain 2 (download dom2.pdb)

Deep-learning Predicted Distance/Contact Map for Domain Assembly

CA distance map with distance < 20Å	CB distance map with distance < 20Å	CA contact map	CB contact map
Download CA distance map	Download CB distance map	Download CA contact map	Download CB contact map

Top 10 Full-length Templates for Domain Assembly

SpinHigh qualityWhite background

Comparison between the best final model and the analogous template

Rank	PDB Hit	TM-score_h	TM-score	RMSD^a	IDEN^b	Cov.	Download Alignment
1	6allB	0.86	0.92	1.98	0.218	1.000	model1_6allB.pdb.gz
2	6allA	0.86	0.91	2.02	0.218	1.000	model1_6allA.pdb.gz
3	3eiwA	0.79	0.84	2.87	0.216	0.989	model1_3eiwA.pdb.gz
4	2whyA	0.78	0.82	2.66	0.151	0.962	model1_2whyA.pdb.gz
5	3tnyA	0.76	0.82	2.93	0.192	0.973	model1_3tnyA.pdb.gz
6	5ad1A	0.76	0.81	2.88	0.170	0.966	model1_5ad1A.pdb.gz
7	3gfvA	0.76	0.80	2.87	0.157	0.947	model1_3gfvA.pdb.gz
8	6mflA	0.75	0.80	2.94	0.133	0.950	model1_6mflA.pdb.gz
9	5joqA	0.75	0.76	3.25	0.146	0.943	model1_5joqA.pdb.gz
10	4jccA	0.75	0.80	2.92	0.152	0.954	model1_4jccA.pdb.gz

(a)	Query structure is shown in cartoon, while the structural analogous template is displayed using backbone trace.
(c)	TM-score_h is the score of the template, which is calculated based on harmonic mean of TM-scores between all domain models and the template.
(b)	Ranking of proteins is based on the TM-score_h.
(c)	RMSD^a is the RMSD between residues that are structurally aligned by TM-align.
(d)	IDEN^b is the percentage sequence identity in the structurally aligned region.
(e)	Cov. represents the coverage of the alignment by TM-align and is equal to the number of structurally aligned residues divided by length of the query protein.

Final Full-length Models Assembled by DEMO

SpinHigh qualityWhite background

Top 5 models constructed by DEMO

Click to view	eTM-score	eRMSD(Å)	PDB file
Model 1	0.95+-0.06	2.5+-1.1	Download model
Model 2	0.93+-0.07	2.6+-0.9	Download model
Model 3	0.93+-0.10	2.6+-1.2	Download model
Model 4	0.90+-0.11	2.8+-0.8	Download model
Model 5	0.90+-0.13	2.9+-1.0	Download model

(a)	Colored by domain: domain 1 in red; domain 2 in blue.
(b)	For each target, DEMO generates an ensemble of structural conformations by starting from a set of initial models generated by different templates. The server reports up to five final models sorted by the energy. The accuracy of each model is quantitatively evaluated by estimated TM-score (eTM-score) and estimated RMSD (eRMSD) that are calculated based on the significance of the structural analogous templates for domain models assembly, convergence parameters of the domain assembly simulations, satisfaction degrees of the inter-domain distances/interfaces, and the estimated accuracy of the individual domain model. eTM-score is typically in the range of [0,1], where an eTM-score of higher value signifies a model with a high confidence and vice-versa.
(d)	Since the top 5 models are ranked by the energy, it is possible that the lower-rank models have a higher eTM-score in rare cases. Although the first model has a better quality in most cases, it is also possible that the lower-rank models have a better quality than the higher-rank models as seen in our benchmark tests.
	More about eTM-score and eRMSD

[Back to DEMO server]

Reference:

Xiaogen Zhou, Chunxiang Peng, Wei Zheng, Yang Li, Guijun Zhang, Yang Zhang. DEMO2: Multi-domain protein structures assembly by coupling quaternary structural alignment with deep-learning inter-domain restraint prediction, to be submitted.

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417