[Back to DAMpred server]

DAMpred results for job DAM100001 (your_protein)

Disease-associated Mutation Prediction


  • User Input
    Download the protein sequence

    >sequence
    KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKM
    VENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHL
    RKSEAQAKKEKLNIWS

    Download the mutation list

    L20A
    K105M


  • By right-clicking on the images, you can change the configurations, e.g. modifying the background color or stopping the spin of your models.
    Download the predicted 3D model by I-TASSER



  • Download the predicted results (">1" means Disease-associated Mutation).

    Position Wild-type mutant type SD SN SΔ prediction
    20 L A 0.216 0.838 -0.059 neutral
    105 K M 0.561 0.570 0.270 neutral


  • Download top 20 features with the lowest P-value (>> for further explanation of features...).

    Position Wild-type mutant type PSICw PSICm dPSIC tPSICw dtPSIC noCw noCm noARm Intra CIntra
    20 L A 0.471 0.056 -0.415 0.497 -0.231 8 5 3 0 0
    105 K M 0.704 -0.874 -1.578 0.55 0.133 4 5 6 0 0


    Position Wild-type mutant type coswm rmsNwm rmsNSwm Pfamw Pfamm dPfam JSDi Depth dVDW CISRRm
    20 L A 0.8 2.661 2.683 # # # 0.471 9.09 2.365 7.270
    105 K M 0.6 2.062 1.612 2.712 3.667 0.954 0.289 4.87 0.779 3.151



    • Please cite the following articles when you use the DAMpred server:
    1. Lijun Quan, Hongjie Wu, Qiang Lyu , and Yang Zhang, DAMpred: Recognizing disease-associated nsSNP mutations through Bayes-guided neural-network model built on low-resolution structure prediction of proteins and protein-protein interactions, Submitted (2018)