Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | NTRRCWLCGESLLGHIPFHYLDFSFCSTKCLQAHRQGKAAP |
1 | 3j3bW | 0.18 | 0.17 | 0.93 | 1.17 | DEthreader | | KVELCSFSGYKIYPGHGRRYARVQFLNAKCESAFLSKR--- |
2 | 2n94A | 0.17 | 0.17 | 0.98 | 1.94 | SPARKS-K | | MAVLCGVCGIK-EFKYKCPRCLVQTCSLECSKKHKTRDNCS |
3 | 5xxbV | 0.16 | 0.15 | 0.93 | 1.00 | DEthreader | | KTDMCSFSEYRIYGRGQRFVGKVHTFHRKEASLFRQKI--- |
4 | 3u5eW | 0.16 | 0.15 | 0.93 | 1.00 | DEthreader | | KVEIDSFSGAKIYPGRGTLFVIFRFQNSKSASLFKQRK--- |
5 | 5datn4 | 0.11 | 0.10 | 0.93 | 1.00 | DEthreader | | KVEIDSFSGAKIYPGRGTLFVRIFRFNSKSASLFKQRK--- |
6 | 2n94A | 0.18 | 0.17 | 0.95 | 0.35 | HHpred | | MAVLCGVCGIK-EFKYKCPRCLVQTCSLECSKKHKTRDNC- |
7 | 2n94A | 0.21 | 0.17 | 0.83 | 0.75 | DisCoVER | | MAVLCGVCGIKEF---KYKCPRVQTCSLECSKKHKTR---- |
8 | 2yqqA | 0.22 | 0.20 | 0.88 | 0.42 | MRFsearch | | -TVVCVICLEKP--KYRCPACRVPYCSVVCFRKHKEQCN-- |
9 | 5aieA | 0.20 | 0.20 | 0.98 | 1.49 | SPARKS-K | | MEDYCPLCIEPMDITDKPCPCGYQIC-QFCYNNIRQNPELN |
10 | 3f2gB | 0.13 | 0.12 | 0.93 | 0.71 | MAPalign | | VSSHCAATGAPVSPAGMAVSLVLFFASVPTAEDWASKH--- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|