Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | MFSIFAQPAQTSVSETQESPANHGANPGKSGSGLGYSTCVVA |
1 | 2mxyA | 0.06 | 0.05 | 0.74 | 0.57 | DisCoVER | | SRVFIGNLVEAIF----------SKYGKIVGCSVHKGFAFV- |
2 | 6vyvE2 | 0.05 | 0.05 | 1.00 | 0.52 | CEthreader | | APDVTYGKKEVTLRLHPDHPTLFSYRSPYEEWVDKFSERIIP |
3 | 1ueyA | 0.10 | 0.10 | 0.98 | 0.52 | EigenThreader | | YDVPPGDNNSPITKFIIEYEDAM-HKPGLYVNYSFRVMAVNS |
4 | 2v7tA1 | 0.28 | 0.17 | 0.60 | 0.25 | HHpred | | ------------AVRI-KQAAKGGARGQWAGSGAGFER---- |
5 | 2pffB | 0.31 | 0.12 | 0.38 | 1.65 | MRFsearch | | -------------------GFKQGGGGGGGGGGGG------- |
6 | 5w3nA | 0.18 | 0.17 | 0.90 | 0.19 | FFAS-3D | | SYSGYSQSTDTSGYGQSSYSSSQNTGYGTQSTPQGYGS---- |
7 | 1zvoC2 | 0.07 | 0.05 | 0.71 | 0.90 | SPARKS-K | | -----GSLAKATGEEKKKEKEKEEQEERETKTPEC------- |
8 | 5b2cA | 0.22 | 0.12 | 0.55 | 0.38 | CNFpred | | --PMFKTLKIQYLSDG-----------------LNRKSCSIA |
9 | 5j5uA | 0.08 | 0.07 | 0.88 | 0.83 | DEthreader | | SLLIDYRDNGDPRLKMATPKTGPIGPGE---E-LYESGI-IT |
10 | 2kghA | 0.13 | 0.12 | 0.93 | 0.79 | MUSTER | | ---IFECVFSCDIKKEGKPCKPKGEKKCTGGWRCKIKLCLKI |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|