Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | NFTRWLRRLDIELDKITGGIGLTRNDFADWRYAVAFTNGIAPRQAAIDMLAEDH |
1 | 2vlaA | 0.10 | 0.09 | 0.94 | 1.17 | DEthreader | | RQFPYILQVLLTADNNN--I-QLSKDDIAYYVLSQVLQKIKPIEVIEKIIEDRT |
2 | 1d3uB | 0.16 | 0.15 | 0.94 | 1.17 | DEthreader | | AAERNLAFALSELDRITALPREE-EAARLEAVGLI-R-GRSIESVMAACVYAAC |
3 | 2vlaA2 | 0.10 | 0.09 | 0.94 | 1.17 | DEthreader | | RQFPYILQVLLTADNNN--I-QLSKDDIAYYVLSQVLQKIKPIEVIEKIIEDRT |
4 | 4yooA2 | 0.04 | 0.04 | 0.96 | 1.17 | DEthreader | | FYRKVYHLASVRLRDLCLSNERRKIWTCF-TLPDLMK-DRHLDQLLLCAFYIMA |
5 | 5yixA1 | 0.15 | 0.13 | 0.89 | 0.68 | DisCoVER | | ----NLRLVISIAKKYTRGLQFLIQEGN-IGLMKAVRGYKFSTYATWWIRQAI- |
6 | 5wtnA | 0.14 | 0.13 | 0.91 | 1.17 | DEthreader | | GV-FDFELFFAGLSKQL----VPRRAVTVKAIKKLAFYGIPPLEMQKLVLGVID |
7 | 5yixA1 | 0.04 | 0.04 | 0.96 | 0.80 | CEthreader | | -NLRLVISIAKKYTNRGLQFLDLIQEGN-IGLMKAVDKSTYATWWIRQAITRSI |
8 | 4oojA2 | 0.19 | 0.19 | 1.00 | 0.72 | EigenThreader | | PFYKISIRVQYLLAEANIYCANFGEFFDKKRVKEGFTQGADIEPIIYDYINSNH |
9 | 6ckqA | 0.08 | 0.07 | 0.93 | 0.20 | HHpred | | GVIREHATLAEAISPS---LDRPIDQLSPVTYELTHQIETPYRVIINEAVELA- |
10 | 4h3tA | 0.18 | 0.15 | 0.81 | 0.42 | MRFsearch | | --PALLRLVLALAYRILRGP------KDDAEWGRLWEADRFSEDAIDDYFAR-- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|