Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | QRRFLGLPCESQVQQNQIRFQVICSQNQVSVKYPRGEISL |
1 | 2f73B | 0.03 | 0.03 | 0.95 | 1.17 | DEthreader | | V-S-EIVQNKLVTTFKNIKSVTELNGDIITNTMTIFKRIS |
2 | 5woxA | 0.07 | 0.07 | 1.00 | 1.17 | DEthreader | | AVAISDQGAGTVATWKDVKATVDVAGHTVIEKDSSLVSNW |
3 | 5fq6B | 0.05 | 0.05 | 0.97 | 1.17 | DEthreader | | V-VDITTKYVSFSQISDKYTFSARGSSSSLNYAYERFYGK |
4 | 4efzA | 0.03 | 0.03 | 1.00 | 1.17 | DEthreader | | HVAIGRLDDGDTLALGALSIRAMHTPACMTYVVTAAAFVG |
5 | 1giyD2 | 0.17 | 0.15 | 0.90 | 0.55 | DisCoVER | | ---LENIPVGTLVHAAGTSAQVLGKGKYVIVRLASEVRM- |
6 | 2ftbA | 0.05 | 0.05 | 0.95 | 1.17 | DEthreader | | I--IEIQQGKLVSKTDQFSHIQEVKGNEMVETLTTLIRRS |
7 | 1ealA | 0.10 | 0.10 | 1.00 | 0.57 | CEthreader | | HSITNTFTIGKECDIETFKATVQMEGGKVVVNSPNYHHTA |
8 | 3hs0F3 | 0.05 | 0.05 | 1.00 | 0.58 | EigenThreader | | NVKGNQIYFTYLILNKGSFRVAYYQVNEVADSDVVYSGNN |
9 | 3fbqA1 | 0.12 | 0.10 | 0.82 | 0.23 | HHpred | | ----FSTELNMTRESNGVKVTIISDGRTLSITYSLES--- |
10 | 2zx0A | 0.24 | 0.23 | 0.95 | 0.40 | MRFsearch | | --FVFGDPCVGTYKYLDTISSIICEGSDSQLLCDRGEIRI |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|