Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | QERFPSDLDLDMFNGSLECDVESIIRSELMDADGLDFNFDS |
1 | 1sseA | 0.19 | 0.07 | 0.39 | 0.77 | DisCoVER | | --MFSNDFN------FENQFDE--QV--------------- |
2 | 6o6jA | 0.05 | 0.05 | 0.98 | 1.00 | DEthreader | | DHDVIGRLQCPLAQI-EKSELVSMALAMVAEDRQIVLELNE |
3 | 6tnfB | 0.07 | 0.07 | 1.00 | 0.51 | CEthreader | | LRELAQDIHACLGDIDQDVEIESRSHFAIVNVKTAAPTVCL |
4 | 1goaA | 0.10 | 0.10 | 1.00 | 0.58 | EigenThreader | | MLKDGSCLGYGAIRGRSAGYNNRMELMAAIVALEALSQYVR |
5 | 2lqhB | 0.61 | 0.46 | 0.76 | 0.68 | HHpred | | -SLSHSDGGGGSGGGSLECDMESIIRSELMDA--------- |
6 | 2lqhB | 0.89 | 0.41 | 0.46 | 0.63 | MRFsearch | | -------------GGSLECDMESIIRSELMDA--------- |
7 | 2lqhB | 0.94 | 0.39 | 0.41 | 0.33 | FFAS-3D | | --------------GSLECDMESIIRSELMD---------- |
8 | 2ztdA2 | 0.07 | 0.07 | 0.98 | 0.79 | SPARKS-K | | -AVRSPVVEALVGLGFAAKQAEEATDTVLAANHDATTSSAL |
9 | 2w8bA | 0.14 | 0.07 | 0.54 | 0.37 | CNFpred | | -------------------DIGGIVAADLRNSGKFNPLDRA |
10 | 4he8N1 | 0.05 | 0.05 | 1.00 | 1.00 | DEthreader | | ALGLAALASLLLTWGDQVFTLLALLGALWTVGLVFYVLALH |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|