Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | NNQTYEVSYLFEHDGIKVYRFMDMGNYVYFTTKGDVTSIKNDSTKER |
1 | 2gopA1 | 0.07 | 0.06 | 0.91 | 1.17 | DEthreader | | --KFAYLSDPRTKGELVAYVLTKAYENTIVIEARRFIENRANKVK-- |
2 | 5uw3A | 0.11 | 0.11 | 0.98 | 1.17 | DEthreader | | -SKKDLLESAHAVNNQLILRYLSDVKHVLEIRLQHRLPIDGSFTSTR |
3 | 2gopA | 0.07 | 0.06 | 0.91 | 1.17 | DEthreader | | --KFAYLSDPRTKGELVAYVLTKAYENTIVIEARRFIENRANKVK-- |
4 | 2xn0A1 | 0.07 | 0.06 | 0.85 | 1.00 | DEthreader | | SAGALFLAYKSYKILIVTLEDK--VSKLEYDLSVQVHNHGEP----- |
5 | 4by2A2 | 0.12 | 0.11 | 0.85 | 0.62 | DisCoVER | | -FPNNSIKIVDPSDTEKLEEWRYAGTHLVQLRNGDKILNLP------ |
6 | 3ei2A3 | 0.02 | 0.02 | 0.96 | 1.17 | DEthreader | | -FKYESPRKICYQEQCFGVLSSRIEVHNLLIIELHAHQFLEAMPKQ- |
7 | 2fkjA | 0.17 | 0.17 | 1.00 | 0.46 | CEthreader | | KNNGSGVLEGVKADKSKVKLTISLGQTTLEVFKESKKVTSKDKSSTE |
8 | 2lnjA | 0.11 | 0.11 | 0.98 | 0.57 | EigenThreader | | GDRQANAEARDED-GQVYYTLEYGDDLASVTTGKITFDLSTAEDRWD |
9 | 1vs0B | 0.14 | 0.11 | 0.79 | 0.24 | HHpred | | KASQWAFEG---WDGYRLLVEADHGAVRLRSRSGRDVTAE------- |
10 | 1zsoB | 0.26 | 0.21 | 0.81 | 0.42 | MRFsearch | | ---EWRDFASFECRGIELIDFFPSNNFIVEDTKGKLYYDVN------ |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|