Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threading program | | 20 40
| | |
| Seq | KGMVLVVALLLIAALAVLGTTAVLTSTTDMKISSNYKTNNEAFFIAEAG |
1 | 6h9lA | 0.08 | 0.08 | 1.00 | 1.67 | DEthreader | | DIEALRKATKEDIEDLREATKEDIEALRKATKEDIEALREDIEALRKAT |
2 | 6h9lA | 0.08 | 0.08 | 1.00 | 1.67 | DEthreader | | ATKEDIEALRKATKEDIEDLREATKEDIEALRKATKEDIEALREDIEAL |
3 | 4p6vC1 | 0.50 | 0.02 | 0.04 | 1.22 | DisCoVER | | AG----------------------------------------------- |
4 | 3dl8C | 0.14 | 0.10 | 0.71 | 1.31 | SPARKS-K | | --KATISVIIFSLAIGVYLWILDLTFTKIISFILSLR------------ |
5 | 6b8hb | 0.06 | 0.06 | 1.00 | 1.67 | DEthreader | | TVELESEAFELKQKVELAHEAKAVLDSWVRYEASLRQLEQRQLAKSVIS |
6 | 6iqeA | 0.10 | 0.10 | 1.00 | 1.67 | DEthreader | | SFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAK |
7 | 7jg5b | 0.10 | 0.10 | 1.00 | 1.67 | DEthreader | | KQVAAAQADYEKEMAEARAQASALRDEARAAGRSVVDEKRAQASGEVAQ |
8 | 5lqxV | 0.10 | 0.10 | 1.00 | 1.67 | DEthreader | | TAALEAEAFELKQKVAVASEAKSVLDSWVRYEAQVRQHEQEQLASTVIS |
9 | 6irdB | 0.00 | 0.00 | 1.00 | 1.67 | DEthreader | | EWSEMINTHSAEEQEIRDLHLSQQCELLRKLLINAHEQQTQQLKLSHDR |
10 | 6gmhQ | 0.06 | 0.06 | 1.00 | 1.67 | DEthreader | | NDEEERELRAKQEQEKELLRQKLLKEQEEKRLREKEEQKKLLEQRAQYV |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|