Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | MSKAKGKGGTGRGTGKKGWNRWQASAKKKKNAKPYKSKGT |
1 | 6sw90 | 0.32 | 0.28 | 0.85 | 1.31 | SPARKS-K | | MKRRP------RKWKKKGRMRWKWIKKRIRRLKRQKERGL |
2 | 2ze6A | 0.00 | 0.00 | 1.00 | 1.17 | DEthreader | | DGRCAIRFAHLIRHVELIEAIANEYLEHALSQERDFPQWP |
3 | 1zvoC2 | 0.21 | 0.20 | 0.97 | 1.05 | MUSTER | | LAKATTAPATTRNTGRGG-EEKKKEKEKEEQEERETKTPE |
4 | 6lo8A | 0.08 | 0.07 | 0.97 | 1.17 | DEthreader | | GFTGAGL-AYKAGPQAALMGGAGFAAFSAAIDLYKSDGRP |
5 | 1wijA | 0.00 | 0.00 | 0.05 | 0.57 | DisCoVER | | --------------------------------IQ------ |
6 | 6xe6A | 0.05 | 0.05 | 0.97 | 0.67 | DEthreader | | AILEFYQDSDGTASVTI-SAVGLSVDFVHYGAYRRPCGQI |
7 | 1zcjA2 | 0.15 | 0.15 | 1.00 | 0.57 | CEthreader | | LGDMLCEAGRFGQKTGKGWYQYDKPLGRIHKPDPWLSTFL |
8 | 5a1uE6 | 0.05 | 0.05 | 1.00 | 0.58 | EigenThreader | | EEVRAGAVSVMDDDNEVRDRATFYLNVLEQKALNAGYILN |
9 | 5o6uF1 | 0.34 | 0.25 | 0.72 | 0.23 | HHpred | | MTTAKTKAGGISGISKRGFTKYTTGPKKT----------- |
10 | 1vt4I3 | 0.41 | 0.17 | 0.42 | 0.48 | MRFsearch | | -GGGGGGGGGGGGGGGGG---------------------- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|