Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | NRVRFSSSTKPDLFEKLKQLSEQTRIPISKLIDEALEDLIKKYK |
1 | 2kelA | 0.23 | 0.20 | 0.91 | 1.33 | DEthreader | | ----FGIYMDKDLKTRLKVYCAKNNLQLTQAIEEAIKEYLQKRN |
2 | 6a6xC | 0.12 | 0.11 | 0.98 | 1.33 | DEthreader | | -STSTTIRVSTQTRDRLAAQARERGISMSALLTELAAQAERQAI |
3 | 1oz9A | 0.07 | 0.07 | 1.00 | 1.33 | DEthreader | | LKKRRKIYITDDSQDTAERQARELGHSLEEEVKRLIVHGIVHLL |
4 | 1yixA | 0.03 | 0.02 | 0.89 | 1.33 | DEthreader | | KAR----DVA-MVRDVAEYMAVLKGVAVEELAQVTTDNFARLFH |
5 | 2gpeD | 0.11 | 0.11 | 1.00 | 1.33 | DEthreader | | GTTTMGVKLDDATRERIKSAATRIDRTPHWLIKQAIFSYLEQLE |
6 | 2caxA | 0.23 | 0.23 | 1.00 | 0.78 | HHpred | | IMGDKTVRVRADLHHIIKIETAKNGGNVKEVMDQALEEYIRKYL |
7 | 2cpgB | 0.17 | 0.11 | 0.66 | 0.83 | DisCoVER | | ---RLTITLSESVLENLEKMAREMGLSKSAMI------------ |
8 | 2cpgB | 0.21 | 0.20 | 0.95 | 0.68 | MRFsearch | | --KRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQE |
9 | 4g0bA | 0.05 | 0.05 | 1.00 | 0.89 | MAPalign | | LKSKEDISYSSYEMLAGHVWRCAGDLEVWYAASKIHDALARMDN |
10 | 3c19A2 | 0.11 | 0.11 | 1.00 | 0.52 | CEthreader | | IAETEEGEVVTVKFDECREIGEETGIPPREVKAMVEAAARVGGW |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|