Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | LRQLPSVDELLQEPSIREMVQALPRWAVVEAIREVLERWR |
1 | 6w4sF | 0.03 | 0.03 | 0.97 | 1.17 | DEthreader | | GHSGDRWHF-AAPMAVGQIMTFGSPVIGCGFISGWNLVSM |
2 | 6a8zA | 0.08 | 0.07 | 0.97 | 1.17 | DEthreader | | PVDVSAYAE-LAALALHALRLKVGDAAFGQFLHSYVKTFT |
3 | 6eqoA | 0.07 | 0.07 | 1.00 | 1.34 | MAPalign | | NLRLLPGGGTQRALDAVRTGWTQGMTAGLECEAQRFAEAI |
4 | 5lsjB | 0.11 | 0.10 | 0.93 | 1.17 | DEthreader | | FLQVASYQRFTDC--YKCFYQ-LQPAMTQQIYDKFIAQLQ |
5 | 6tbdA | 0.08 | 0.07 | 0.95 | 1.17 | DEthreader | | PFNARR--ALEPQDIARRFRSFGTPTQVRRFVHAHRAWLS |
6 | 3ciaA | 0.12 | 0.12 | 1.00 | 1.17 | DEthreader | | AINLTSYVENRVQLFLMYLEEKFGRERFDAFVLEYFDSHA |
7 | 3jacA | 0.00 | 0.00 | 0.85 | 1.11 | MAPalign | | GGGGGGGGGGG----G--GGGGGGGGGGGGGGGGGGGGGG |
8 | 5l9wA | 0.13 | 0.12 | 0.95 | 1.17 | DEthreader | | -LKPAMTAWT-VRTRIIELCEREGADYVTGLFRKMLQVAE |
9 | 3letA | 0.13 | 0.12 | 0.95 | 1.17 | DEthreader | | --AEAMTEVMLETDSGKNLKALIGDDAVKSLAVRVVKDYG |
10 | 5lsjB | 0.11 | 0.10 | 0.93 | 1.17 | DEthreader | | LKLVGSYQRFTDC--YKCFYQ-LQPAMTQQIYDKFIAQLQ |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|