Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | EPKPSYVKLAMRNMVRKRGTSLKHFFLTTVGLLGVLIGLAYLTR |
1 | 6yvuB | 0.14 | 0.14 | 1.00 | 1.33 | DEthreader | | EIKAQRKEIKDRISSCSKEKTLVLERRELEGTRVSLEERTKNLV |
2 | 4tshA | 0.09 | 0.09 | 1.00 | 1.50 | DEthreader | | KTAEEAVQKETEIKEDYTKQAEDIKKTTDQYKSDVAAHEAEVAK |
3 | 1mztA | 0.16 | 0.14 | 0.86 | 1.03 | SPARKS-K | | ------AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKK |
4 | 4hl7A | 0.05 | 0.05 | 0.98 | 1.17 | DEthreader | | ILYLV-AIVSEVRSRQWAEVPADLPLKVLKTKLDQLKAEIERRG |
5 | 6cfzD | 0.05 | 0.05 | 1.00 | 1.17 | DEthreader | | GVRKINEVIEGMIGTLEAKGNMGTVSQTVTNATTLLNTWTRMLS |
6 | 6b3rA1 | 0.05 | 0.05 | 1.00 | 1.50 | DEthreader | | AASRGFALYNAANLKSINFHRQIEEKSLAQLKRQMKRIRAKQEK |
7 | 5xu1M | 0.18 | 0.16 | 0.89 | 0.37 | HHpred | | ----QNLKFAFSSIMAHKMRSLLTMIGIIIGVSSVVVIMALGD- |
8 | 2wwaB | 0.50 | 0.05 | 0.09 | 0.71 | DisCoVER | | CKKP---------------------------------------- |
9 | 5gkoA2 | 0.10 | 0.09 | 0.95 | 0.43 | MRFsearch | | --TLDRLSEAFQALLSNAHRRTFLTLGIIIGIASVVTVVALGNG |
10 | 5lj3S2 | 0.06 | 0.05 | 0.82 | 0.92 | SPARKS-K | | --KEAKIVLLQKYITFEARKLYRRYLELSWIEFAMYQT------ |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|