Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | WGFVAVAAFFLLSEHRAHLFGWLPYLLLLACPLMHLFMHGGHNGHGESHDD |
1 | 6e2jA | 0.10 | 0.10 | 1.00 | 1.50 | DEthreader | | EINKRTNAENEFVTIKKDVDGAYMTKVDLQAKLDNLQQEIDFTAYQAELQQ |
2 | 4mt4A | 0.06 | 0.06 | 0.96 | 1.33 | DEthreader | | NYQNTLITAFGEIRYALVARKTIRLQYDNAQASEQSYKRIYEIERYEMD-- |
3 | 3dl8C | 0.06 | 0.04 | 0.67 | 1.40 | SPARKS-K | | ATISVIIFSLAIGVYLWILDLTFTKIISFILSLR----------------- |
4 | 6c70A | 0.06 | 0.06 | 0.92 | 1.17 | DEthreader | | HKHVVRLVTAVGDAYGVALLLHMLTTTITLTLLAYQATKVN---GV-NVAT |
5 | 4kqtA | 0.02 | 0.02 | 0.98 | 1.50 | DEthreader | | ALEQQAATLQAKANAWQRKGQLRQKEVEATEQKALSRVYQELTPIQQY-QK |
6 | 4v1av | 0.09 | 0.08 | 0.90 | 1.33 | DEthreader | | QQLAEEQKRQAREQLIEECMAKMPQMIENWRQQQQERRGGGGGGG-G---- |
7 | 6bwdA | 0.16 | 0.10 | 0.61 | 0.21 | HHpred | | ------YAFYPIVKFWFNTLAYLGFLMLYTFVVLVKM-------------- |
8 | 1hh0A | 0.00 | 0.00 | 0.04 | 0.99 | DisCoVER | | -----------------------------DF-------------------- |
9 | 3dh4A | 0.15 | 0.12 | 0.78 | 0.25 | MRFsearch | | -GLALFALVYSIVVWTDVIQVFFLVLGGFMTTYMAVSFIGG---------- |
10 | 1mztA | 0.09 | 0.06 | 0.63 | 1.10 | SPARKS-K | | LQASATEYIGYAWAMVVVIVGATIGIKLFKKF------------------- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|