Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | NKERKRKWRNANIVKNWENDVRARLKKRSKTDFIDLTQDEKDEWVEVEF |
1 | 2basA | 0.08 | 0.08 | 0.98 | 1.33 | DEthreader | | ITHEKKKLETVYEHSEQFYKRVHQAVTSLRKNNLS-SDDDFIKKLAEEL |
2 | 5llmA | 0.10 | 0.10 | 1.00 | 1.50 | DEthreader | | AKASGRLGMRAVVYYMSTTIIAVVLGIILVLIIHPQMYMVTVIVGLVIH |
3 | 1v4aA | 0.06 | 0.06 | 0.98 | 1.33 | DEthreader | | VTEESILQQLSYLAETLIVAARDWLYDACCREWTPCNENQFFTR-GQRL |
4 | 5llmA2 | 0.10 | 0.10 | 1.00 | 1.50 | DEthreader | | AKASGRLGMRAVVYYMSTTIIAVVLGIILVLIIHPQMYMVTVIVGLVIH |
5 | 4ogcA3 | 0.04 | 0.02 | 0.51 | 0.55 | DisCoVER | | ---------------------DIVRLDALELQCACLYCGTT-IGYH-L- |
6 | 1v4aA2 | 0.06 | 0.06 | 0.98 | 1.33 | DEthreader | | VTEESILQQLSYLAETLIVAARDWLYDACCREWTPCNENQFFTR-GQRL |
7 | 6g7cA2 | 0.06 | 0.06 | 1.00 | 0.51 | CEthreader | | PRDRFHALLVQAELLALARQHYQHLWQEASRLGLSHWEPGLVNRLESLA |
8 | 5jghA | 0.10 | 0.10 | 1.00 | 0.48 | EigenThreader | | KASKRTQLRNELIKQGAYFLYLQDHRSQFVKENPTLRPAEISKIAGEKW |
9 | 6gw6B | 0.09 | 0.08 | 0.90 | 0.22 | HHpred | | ---TLKSRIERDQPLTVDSDRSAHITAMAEAVFG--EAGKAKRWLSKPK |
10 | 5jghA | 0.20 | 0.18 | 0.94 | 0.40 | MRFsearch | | --DIKEKYISERKKLYSEYQKALDLMKIIGDKWQSLDQSIKDKYIQEY- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|