Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | LEFIIYPDGRVQEKVTGIIGSSCQEVTAAIEAQLGQVVSQEKTSDYY |
1 | 4grcA | 0.06 | 0.06 | 1.00 | 1.17 | DEthreader | | LTIGFGPSLDLCVQACADDPQVAVHAIRNLARIGVVVRWSQLGFGKP |
2 | 4fdfA | 0.07 | 0.06 | 0.94 | 1.17 | DEthreader | | VDFTVGQL-DIEITAT-VVEMEALTAVSVAALTLYLIDDIRVL-HKR |
3 | 3w8wA2 | 0.07 | 0.06 | 0.94 | 1.17 | DEthreader | | LTWALYLRICAMSCWI-GDPHEGERQLESILHAGKPHLTKATLPY-- |
4 | 1vr7A | 0.09 | 0.09 | 0.96 | 1.17 | DEthreader | | LTIHTWEYGYAAIDLF-TCEVDPWKAFEHLKKALKARVHVVEHER-G |
5 | 4grcA | 0.06 | 0.06 | 1.00 | 1.17 | DEthreader | | LTIGFGPSLDLCVQACADDPQVAVHAIRNLARIGVVVRWSQLGFGKF |
6 | 3gl3A | 0.26 | 0.19 | 0.74 | 0.28 | HHpred | | TSFLIDRNGKVLLQHVGFRPADKEALEQQILAALG------------ |
7 | 5o60J1 | 0.11 | 0.06 | 0.60 | 0.70 | DisCoVER | | KLQIQAQRGNVIPVEITVYEDRSFTFA--L----------------- |
8 | 3gl3A | 0.26 | 0.19 | 0.72 | 0.38 | MRFsearch | | -SFLIDRNGKVLLQHVGFRPADKEALEQQILAALG------------ |
9 | 2n2uA | 0.10 | 0.09 | 0.87 | 0.87 | SPARKS-K | | VDLKIDTNGDIKLDAQT------EKEAEKMEKAVKKVTIRKTGGSLE |
10 | 1t3qB | 0.17 | 0.17 | 0.98 | 0.95 | MAPalign | | ATVRIDPTGKVTVTTSLSSGQGHETLAQIAADVLVPAVVIQATYGF- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|