Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | MPTYDYRCGKCGHQFEVFQSITDNPLTECPSCGGSVERLI |
1 | 4pofA | 0.21 | 0.20 | 0.97 | 1.00 | DEthreader | | VSVAVFVCKDCGHEMIVPQKESLE-KVKCECGSKNIELDV |
2 | 2b4yC | 0.28 | 0.28 | 1.00 | 1.17 | DEthreader | | GELFKTRCTSCGVVAENYKSPIALILPRCEECGGLLRPHV |
3 | 3ir9A2 | 0.24 | 0.23 | 0.95 | 1.00 | DisCoVER | | AERVTTKCSVCGYENKWTRRWKP-AAGNCPKCGSSLEVT- |
4 | 3ir9A2 | 0.23 | 0.23 | 1.00 | 2.65 | SPARKS-K | | AERVTTKCSVCGYENKWTRRWKPPAAGNCPKCGSSLEVTD |
5 | 2b4yC | 0.30 | 0.28 | 0.93 | 1.17 | DEthreader | | -GLFKTRCTSCGVVAENYKS--PLKLPRCEECGGLLRPHV |
6 | 4pofA2 | 0.21 | 0.20 | 0.97 | 1.00 | DEthreader | | VSVAVFVCKDCGHEMIVPQKESLE-KVKCECGSKNIELDV |
7 | 2b4yC2 | 0.28 | 0.28 | 0.97 | 1.17 | DEthreader | | -RLFKTRCTSCGVVAENYKSPIALILPRCEECGGLLRPHV |
8 | 2m6oA | 0.34 | 0.33 | 0.95 | 2.09 | SPARKS-K | | -QAVEYACEK-GHRFEMPFSVEAEPEWECKVCGAQALLVD |
9 | 2b4yC2 | 0.30 | 0.28 | 0.93 | 1.17 | DEthreader | | -RLFKTRCTSCGVVAENYKS--PLKLPRCEECGGLLRPHV |
10 | 2xrcA1 | 0.08 | 0.07 | 0.93 | 1.00 | DEthreader | | GWQVAIKDA-SGITCGGIYIGGCWI-T-LRSKTHRYQIWT |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|