Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | MGFFNKDKGKRSEKEKNVIQGALEDAGSALKDDPLQEAVQKKKNNR |
1 | 2fjeA2 | 0.17 | 0.17 | 1.00 | 1.17 | DEthreader | | LFRDGIATYKTNEKMLQRALELLAFLKEDLELAWLVHRVWTAEAHR |
2 | 3rh3A | 0.09 | 0.09 | 1.00 | 1.33 | DEthreader | | AVYVNLKQNYAGLFNVRTQFYDNFNKFLAYKKDAKTAQLLDENYKL |
3 | 2fjeA | 0.17 | 0.17 | 1.00 | 1.17 | DEthreader | | LFRDGIATYKTNEKMLQRALELLAFLKEDLELAWLVHRVWTAEAHR |
4 | 6ek7A2 | 0.19 | 0.17 | 0.91 | 1.33 | DEthreader | | ---R-SIELDEKIKEKRQRIEQLKKDYDKFVSGAKAENARKEKNAL |
5 | 2x9wA4 | 0.08 | 0.04 | 0.57 | 0.64 | DisCoVER | | -----------------KVSQEEKQLVVTTKAQAAYNAAVIAA--- |
6 | 3dd4A | 0.07 | 0.07 | 0.98 | 1.17 | DEthreader | | -FVLEIEDSVELEAQSKFTKKELQILYRGFKPFDFIKGLSILLGTE |
7 | 5cwjA | 0.13 | 0.13 | 1.00 | 0.64 | CEthreader | | RVILRIAKESGSEEALRQAIRAVAEIAKEAQDPRVLEEAIRVIRQI |
8 | 6lmvA | 0.02 | 0.02 | 1.00 | 0.43 | EigenThreader | | GPTAALLLIGITVNLIQSSFLDRCYRSHEFYCPPCICVLEAESQIY |
9 | 6g24A | 0.22 | 0.17 | 0.80 | 0.27 | HHpred | | ----TKIRKPRPQRERAQWDIGIAHAEKALKMTR-EERIEQY---- |
10 | 2pffB | 0.21 | 0.20 | 0.91 | 0.48 | MRFsearch | | ---PDDDYGMDLYKTSKAAQDVWNRADNHFKDTYGFSILDIVINN- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|