Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | PDVDYHWTRFPLLEERAIYRMAHIKLANPRRSLSSQVLLSNFMYNYLAIVQ |
1 | 7ji0A | 0.06 | 0.06 | 0.98 | 1.17 | DEthreader | | LGCVRTLDMEEFTNCFYLIDEIKALLDNE-LNFYEQTVFLYATGYFEFKRW |
2 | 3gi9C | 0.02 | 0.02 | 1.00 | 1.17 | DEthreader | | VSGMFASAIFSAVFMVIYLFVILSHYILDGGRKEIVIFSFIVVLGVFLLLL |
3 | 6tkyB2 | 0.06 | 0.06 | 0.94 | 1.17 | DEthreader | | --V-NAAYALLKEIFRQFADACGQALDVEIYQEELRSHYKDMLSELSTVMN |
4 | 5b86A1 | 0.11 | 0.10 | 0.88 | 1.17 | DEthreader | | -----KEALLVAWQVLALERQLEAAAAAGG-SNEELVWRQSKVEALYVLLC |
5 | 1zl8A | 0.07 | 0.04 | 0.59 | 0.67 | DisCoVER | | --------------VQRILELMEHVQKTG---EVNNAKLASLQQVLQ---- |
6 | 5b86A1 | 0.11 | 0.10 | 0.92 | 1.17 | DEthreader | | ---PTVEELKVAWQVLALERQLEAAAAAGG-SNEELVWRQSKVEALYVLLC |
7 | 6wvgA3 | 0.02 | 0.02 | 0.98 | 0.69 | CEthreader | | -SSLKLLKYVLFFFNLLFWICGCCILGLGNVFVIVGSIIMVVAFLGCMGSI |
8 | 4gfqA2 | 0.08 | 0.08 | 1.00 | 0.40 | EigenThreader | | YSRELATAEEAKVAVRNVRDDLKKLEKAGEITEDDLRGYTEDIQKYIAKVD |
9 | 5mrwA | 0.13 | 0.12 | 0.88 | 0.28 | HHpred | | ----DIPLPGTTGVERVLFRALGVS-DR-EMNWKQAILGLNMLGLFMLLGQ |
10 | 2pffB | 0.18 | 0.14 | 0.76 | 0.37 | MRFsearch | | ---DYGFKGMDLYKTSKAAQDVWNRADN--------HFKDTYGFSILDIV- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|