Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | QRQYAHLHSQLAQLNANLADTENLLRMTAVQAGDMRFLGGYVGAL |
1 | 4bl6A | 0.11 | 0.11 | 1.00 | 1.50 | DEthreader | | AARCEEYVTQVDDLNRQLEAAEEEKKTLNQLLRLAVQQKLALTQR |
2 | 3q0xA | 0.11 | 0.11 | 1.00 | 1.67 | DEthreader | | KGTCHDLSDDLSRTRDDRDSMVAQLAQCRQQLAQLREQYDKHLLE |
3 | 6cfzG | 0.67 | 0.67 | 1.00 | 2.02 | HHpred | | ARQLAHLHSQLTQLSHNLATTENLMRMTAVQAEAMRGLGSWHAGL |
4 | 4ntjA | 0.04 | 0.04 | 1.00 | 1.67 | DEthreader | | FGLVWHEIVNYICQVIFWINFLIVIVCYTLITKELYRSYVRTADL |
5 | 7jg5b | 0.11 | 0.11 | 1.00 | 1.50 | DEthreader | | EMAEARAQASALRDEARAAGRSVVDEKRAQASGEVAQTLTQADQQ |
6 | 2tmaA1 | 0.07 | 0.07 | 1.00 | 1.67 | DEthreader | | KLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDE |
7 | 1x79B | 0.09 | 0.09 | 1.00 | 1.50 | DEthreader | | QLMLRQANDQLEKTMKDKQELEDFIKQSSEDSSHQISALVLRAQA |
8 | 6b3rA1 | 0.11 | 0.11 | 1.00 | 1.50 | DEthreader | | QASRGFALYNAANLKSINFHRQIEEKSLAQLKRQMKRIRAKQEKY |
9 | 2tmaA | 0.07 | 0.07 | 1.00 | 1.67 | DEthreader | | KLDKENALDRAEQAEADKKAAEDRSKQLEDELVSLQKKLKGTEDE |
10 | 6vzfA | 0.00 | 0.00 | 0.04 | 0.75 | DisCoVER | | --NN----------------------------------------- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|