Rank | PDB hit | ID1 | ID2 | Cov | Norm. Zscore | Threadingprogram | | 20 40
| | |
| Seq | MTNKNDGKDMRKNAPKGDNPGQPEPLSGSKKVKNRNHTRQKHN |
1 | 2pffB | 0.18 | 0.12 | 0.65 | 1.30 | MRFsearch | | -------PDDDYGFKQGGGGGGGGDLYKTSKAAQD-------- |
2 | 1zvoC2 | 0.13 | 0.12 | 0.91 | 1.42 | SPARKS-K | | ----GSLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKT |
3 | 1vx74 | 0.42 | 0.12 | 0.28 | 1.05 | CNFpred | | -------------------------------AKSKNHTNHNQN |
4 | 2rujA | 0.00 | 0.00 | 0.21 | 0.62 | DisCoVER | | ------------------------IVEDDGELD---------- |
5 | 5ifeA | 0.05 | 0.05 | 0.93 | 0.83 | DEthreader | | VEQG-PVSEFSPILL-SLQVGILVPFTSHE-DHDFQVEMHLRS |
6 | 2d1gA | 0.09 | 0.09 | 1.00 | 0.43 | CEthreader | | GANGPAMSPSGNLENIENNYIIDDPNPYYDDCSYGTSKSGDTN |
7 | 3fwwA3 | 0.12 | 0.12 | 1.00 | 0.57 | EigenThreader | | RLDANGAELAEGALGKGSSEIGAGVAGTDVFVGNGATIGAGTT |
8 | 2ad6B | 0.27 | 0.16 | 0.60 | 0.26 | HHpred | | ----------EPGNCWENKPGYPEKIAGSKYDPKHD------- |
9 | 1vt4I | 0.14 | 0.07 | 0.49 | 0.77 | MRFsearch | | ---EEAHKQVQRGGGGGGGGGGGG------------------- |
10 | 6lumD | 0.05 | 0.05 | 0.88 | 0.23 | FFAS-3D | | VMEREHDRPAALDHPRAPRKPRGIPYFEKYAWLFMRFS----- |
(a) | ID1 is the number of template residues identical to query divided by number of aligned residues. |
(b) | ID2 is the number of template residues identical to query divided by query sequence length. |
(c) | Cov is equal the number of aligned template residues divided by query sequence length. |
(d) | Norm. Zscore is the normalized Z-score of the threading alignments. A Normalized Z-score >1 means a good alignment and is highlighted in bold. |
(e) | Threading program lists the threading program used to identify the template. |
(f) | Template residues identical to query sequence are highlighted in color. |
|